Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate WP_041575701.1 XAUT_RS16125 serine O-acetyltransferase
Query= BRENDA::C4IRW0 (281 letters) >NCBI__GCF_000017645.1:WP_041575701.1 Length = 289 Score = 336 bits (862), Expect = 3e-97 Identities = 162/261 (62%), Positives = 198/261 (75%) Query: 21 DQVDPIWHSIRAEAEEATRNDPVLGAFLYATILNQPSLEEAVMHRIAERLGHPDVSADIL 80 D VDP+W +R EAEEA +P+L AFL +L QPSLE + RIA RL H DV A + Sbjct: 23 DVVDPVWARLRNEAEEAAEREPLLAAFLIGAVLGQPSLEAVIGERIAARLDHADVPASAI 82 Query: 81 RQTFDTMLEANPEWSHVLRVDIQAVYDRDPAYSRFMDPVLYLKGFHAIQTHRLAHWLYKQ 140 R + + LR DI AV DRDPA +R ++PVLY KGFHAIQTHRL+H+L+ Sbjct: 83 RAAWLEAAARDKTIPQALRADIMAVVDRDPAATRTLEPVLYFKGFHAIQTHRLSHFLWAS 142 Query: 141 GRKDFAYYLQSRSSSIFQTDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHGVTLG 200 G++DFA YLQSR+SS+F DIHP +G G+FLDHATG+V+G TAV+ED+VSIL GVTLG Sbjct: 143 GQRDFALYLQSRASSVFAVDIHPQVPMGRGIFLDHATGVVIGATAVIEDDVSILQGVTLG 202 Query: 201 GTGKSSGDRHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARI 260 GTGK +GDRHPKIR+GVLIGAGAK+LGNI+VG+C++IAAGSVVLK VP N TVAG+PA++ Sbjct: 203 GTGKETGDRHPKIRRGVLIGAGAKVLGNIEVGRCARIAAGSVVLKPVPRNTTVAGIPAKV 262 Query: 261 IGETGCTEPSRVMDQMLGDGI 281 +GE GC EPSR MDQM D I Sbjct: 263 VGEAGCAEPSRSMDQMFEDNI 283 Lambda K H 0.320 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 289 Length adjustment: 26 Effective length of query: 255 Effective length of database: 263 Effective search space: 67065 Effective search space used: 67065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_041575701.1 XAUT_RS16125 (serine O-acetyltransferase)
to HMM TIGR01172 (cysE: serine O-acetyltransferase (EC 2.3.1.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01172.hmm # target sequence database: /tmp/gapView.2215778.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01172 [M=162] Accession: TIGR01172 Description: cysE: serine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-72 228.9 1.0 3.9e-72 227.7 0.9 1.6 2 NCBI__GCF_000017645.1:WP_041575701.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000017645.1:WP_041575701.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.0 0.11 0.11 7 43 .. 38 75 .. 32 85 .. 0.65 2 ! 227.7 0.9 3.9e-72 3.9e-72 2 162 .] 101 261 .. 100 261 .. 0.99 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.11 TIGR01172 7 avlerDPaaesa.levlllykglhallayrlahalykr 43 ++ er+P + +l ++l a++ r+a++l + NCBI__GCF_000017645.1:WP_041575701.1 38 EAAEREPLLAAFlIGAVLGQPSLEAVIGERIAARLDHA 75 55666665544314567778888888888888877554 PP == domain 2 score: 227.7 bits; conditional E-value: 3.9e-72 TIGR01172 2 kedlkavlerDPaaesalevlllykglhallayrlahalykrklkllarllselvrvltgvdihPaakigrgv 74 ++d+ av++rDPaa+++le++l++kg+ha++++rl+h+l+ ++ + +a +l+++++ ++ vdihP+ +grg+ NCBI__GCF_000017645.1:WP_041575701.1 101 RADIMAVVDRDPAATRTLEPVLYFKGFHAIQTHRLSHFLWASGQRDFALYLQSRASSVFAVDIHPQVPMGRGI 173 78*********************************************************************** PP TIGR01172 75 liDhatGvviGetavigddvsiyqgvtLGgtgkekgkRhPtvkegvvigagakvLGnievgenakiGansvvl 147 ++DhatGvviG tavi+ddvsi+qgvtLGgtgke+g+RhP+++ gv+igagakvLGnievg a+i a+svvl NCBI__GCF_000017645.1:WP_041575701.1 174 FLDHATGVVIGATAVIEDDVSILQGVTLGGTGKETGDRHPKIRRGVLIGAGAKVLGNIEVGRCARIAAGSVVL 246 ************************************************************************* PP TIGR01172 148 kdvpaeatvvGvpar 162 k+vp+++tv+G+pa+ NCBI__GCF_000017645.1:WP_041575701.1 247 KPVPRNTTVAGIPAK 261 *************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (162 nodes) Target sequences: 1 (289 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.96 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory