Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_024750185.1 CCE_RS00820 glutamate-1-semialdehyde 2,1-aminomutase
Query= BRENDA::A0A140N9B6 (406 letters) >NCBI__GCF_000017845.1:WP_024750185.1 Length = 433 Score = 149 bits (377), Expect = 1e-40 Identities = 109/296 (36%), Positives = 147/296 (49%), Gaps = 23/296 (7%) Query: 29 EGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAK 88 +G+ +WD G +YID+ G GHAHPE+ AL++ + G E VL A+ Sbjct: 48 KGAYIWDVDGNQYIDYVGTWGPAICGHAHPEVIAALHDALDRGTSFGAPCLLENVL--AE 105 Query: 89 KLIDATFA-DRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRT-LFTV 146 +IDA + + V F NSG EA + L+L R F + + I+ F+ +HG +F V Sbjct: 106 MVIDAVPSIEMVRFVNSGTEACMSVLRLMRAF------TGRDKIIKFQGCYHGHADMFLV 159 Query: 147 SAGGQPAYS--QDFAPLP----ADIRHAAYNDINSASALI---DDSTCAVIVEPIQGEGG 197 AG A D +P A+ A YND+ + AL D VI+EP+ G G Sbjct: 160 QAGSGVATLGLPDSPGVPKTTTANTLTAPYNDLEAVKALFAENPDEIAGVILEPVVGNSG 219 Query: 198 VVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGG 257 V FLQGLREL N + ALL+FDEV TG R A +GVTPDL T K +GGG Sbjct: 220 FVVPDGGFLQGLRELTNEYGALLVFDEVMTGF-RLSYGGAQEKFGVTPDLTTLGKVIGGG 278 Query: 258 FPVGALLATEECARVMTVG---THGTTYGGNPLASAVAGKVLELINTPEMLNGVKQ 310 PVGA ++ ++ T GNPLA K LEL+ P N ++Q Sbjct: 279 LPVGAYGGRKDIMSMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLQKPGTYNQLEQ 334 Lambda K H 0.319 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 453 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 433 Length adjustment: 32 Effective length of query: 374 Effective length of database: 401 Effective search space: 149974 Effective search space used: 149974 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory