Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_024750185.1 CCE_RS00820 glutamate-1-semialdehyde 2,1-aminomutase
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_000017845.1:WP_024750185.1 Length = 433 Score = 152 bits (385), Expect = 1e-41 Identities = 112/328 (34%), Positives = 156/328 (47%), Gaps = 23/328 (7%) Query: 35 QGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAE--TLMAMPQTLPTPMRGEF 92 +GA +WD +GN+YID VG +G A GH +PEV+ A+ + T P L + Sbjct: 48 KGAYIWDVDGNQYIDYVGTWGPAICGHAHPEVIAALHDALDRGTSFGAPCLLENVLAE-- 105 Query: 93 YRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRT-----MGS 147 + A+ P + V VNSGTEA + L+ RA TGR K + + G Sbjct: 106 -MVIDAV--PSIEMVRFVNSGTEACMSVLRLMRAFTGRDKIIKFQGCYHGHADMFLVQAG 162 Query: 148 LSVTWEPKYREPFLPLVEPVEFI--PYNDVEALKRAVDE---ETAAVILEPVQGEGGVRP 202 V P +P + PYND+EA+K E E A VILEPV G G Sbjct: 163 SGVATLGLPDSPGVPKTTTANTLTAPYNDLEAVKALFAENPDEIAGVILEPVVGNSGFVV 222 Query: 203 ATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPL 262 FL+ RE+T E GALL+ DE+ TG R A E FG+ PD+ TL K +GGG+P+ Sbjct: 223 PDGGFLQGLRELTNEYGALLVFDEVMTGF-RLSYGGAQEKFGVTPDLTTLGKVIGGGLPV 281 Query: 263 GVAVMREEVARSMPKGG---HGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFME 319 G R+++ + G T GNPLAM AG+ + L++ + + ++ E Sbjct: 282 GAYGGRKDIMSMVAPAGPMYQAGTLSGNPLAMTAGIKTLELLQKPGTYNQLEQITQQLSE 341 Query: 320 KLRAIPSPKIREVRG--MGLMVGLELKE 345 L I +V G +G M GL E Sbjct: 342 GLLKIAKEAGHQVCGGYIGAMFGLFFTE 369 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 433 Length adjustment: 31 Effective length of query: 364 Effective length of database: 402 Effective search space: 146328 Effective search space used: 146328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory