Align asparagine-oxo-acid transaminase (EC 2.6.1.14); alanine-glyoxylate transaminase (EC 2.6.1.44); serine-glyoxylate transaminase (EC 2.6.1.45) (characterized)
to candidate WP_012709136.1 NGR_RS24245 aminotransferase class V-fold PLP-dependent enzyme
Query= BRENDA::Q56YA5 (401 letters) >NCBI__GCF_000018545.1:WP_012709136.1 Length = 395 Score = 428 bits (1101), Expect = e-124 Identities = 207/379 (54%), Positives = 270/379 (71%), Gaps = 1/379 (0%) Query: 8 GRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFLFPT 67 G +HLF+PGP NIPE + +AMN ED RSP P LT L DVKK+FK +G F++P+ Sbjct: 3 GYNHLFIPGPTNIPEQIRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNRNGRVFIYPS 62 Query: 68 TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLA 127 +GTGAWE+A+TN LSPGDR++ GQFS LW+D +RL VD ++ +WG G + + Sbjct: 63 SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGLEVDCLDREWGTGVPVDLYT 122 Query: 128 SKLSQDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRM 187 +L+ D+ H IKA+ + HNETATGVT+D++AVR LD HPALL VDGVSSI ++DFR Sbjct: 123 ERLAADKAHRIKAVFVTHNETATGVTSDVAAVRAALDASGHPALLFVDGVSSIGSIDFRQ 182 Query: 188 DEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYW 247 DEWGVD A++GSQK LP GLG + S KALEA KT++ ++ +F + D +K G Y+ Sbjct: 183 DEWGVDCAVSGSQKGFMLPAGLGFLSVSQKALEAAKTARHMRCYFSFEDMIKTNDTG-YF 241 Query: 248 PYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNT 307 PYTP QLL+GLRAALD+IFEEGLENI ARH L R AV AWGLK C + +W S+T Sbjct: 242 PYTPPTQLLHGLRAALDVIFEEGLENIFARHRHLADGVRAAVSAWGLKLCATEPKWYSDT 301 Query: 308 VTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLAGVE 367 V+A+ +P IDG +++R A+ YN SLG GL+KVAGKVFRIGHLG++NE+ +LG L+ E Sbjct: 302 VSAIRLPEGIDGVKVIRHAFDTYNTSLGSGLSKVAGKVFRIGHLGSLNEVMVLGALSAAE 361 Query: 368 MILKDVGYPVVMGSGVAAA 386 + L D G + G+GV AA Sbjct: 362 LTLLDCGVKIEPGAGVGAA 380 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 395 Length adjustment: 31 Effective length of query: 370 Effective length of database: 364 Effective search space: 134680 Effective search space used: 134680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory