Align asparagine-oxo-acid transaminase (EC 2.6.1.14); alanine-glyoxylate transaminase (EC 2.6.1.44); serine-glyoxylate transaminase (EC 2.6.1.45) (characterized)
to candidate WP_015888023.1 NGR_RS09380 aminotransferase class V-fold PLP-dependent enzyme
Query= BRENDA::Q56YA5 (401 letters) >NCBI__GCF_000018545.1:WP_015888023.1 Length = 396 Score = 371 bits (953), Expect = e-107 Identities = 182/385 (47%), Positives = 257/385 (66%), Gaps = 2/385 (0%) Query: 12 LFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFLFPTTGTG 71 +F+PGP N+PE + +A + D+RSP + + L VKK+ K+ + + F+FP TGTG Sbjct: 7 VFIPGPTNMPEVLRKASDMPTIDHRSPMFGEILRPGLAGVKKVLKSEAASIFVFPATGTG 66 Query: 72 AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLS 131 WE+A+TNTLSPGDR+++ G FS WID +R NV+++ + WG GA L+ Sbjct: 67 GWETAITNTLSPGDRVLAARNGMFSHRWIDMCQRHGLNVEIILASWGSGAPADRYEEILA 126 Query: 132 QDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWG 191 D+ H IKA+ + HNETATGV +DI+AVR +D +HPA+L VDGVSSI ++DFRMDEWG Sbjct: 127 ADKAHEIKAVLVTHNETATGVRSDIAAVRRAIDAARHPAMLFVDGVSSIASMDFRMDEWG 186 Query: 192 VDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTP 251 VD+A+TGSQK LP GL I SPKAL A +T+K + FFD D K Y+ Y PYTP Sbjct: 187 VDIAVTGSQKGFMLPAGLAITAFSPKALAALETAKLPRTFFDVRDMSKSYENNAY-PYTP 245 Query: 252 SIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAV 311 ++ LL GL+ + +++ EGLEN+ ARH R+ R AV AWGL+ C E+ S+TV+A+ Sbjct: 246 AVGLLNGLKVSTEILLAEGLENVFARHKRIASGVRAAVRAWGLELCATSEDLYSDTVSAI 305 Query: 312 MVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILK 371 P D + +V A ++Y+++ G+GL +VAGKVFRIGHLG++ ++ L +A EM++ Sbjct: 306 RTPEGFDATSVVTHAAKKYDVAFGVGLGEVAGKVFRIGHLGSLTDVMALLGIATAEMVMA 365 Query: 372 DVGYPVVMGSGVAAAST-YLQHHIP 395 D+G + +GSGVAAA Y H+P Sbjct: 366 DLGLAIKLGSGVAAAQEFYRSSHVP 390 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 396 Length adjustment: 31 Effective length of query: 370 Effective length of database: 365 Effective search space: 135050 Effective search space used: 135050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory