Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (characterized)
to candidate WP_164924727.1 NGR_RS30500 M20 family metallopeptidase
Query= SwissProt::O34916 (374 letters) >NCBI__GCF_000018545.1:WP_164924727.1 Length = 398 Score = 189 bits (481), Expect = 9e-53 Identities = 116/354 (32%), Positives = 187/354 (52%), Gaps = 13/354 (3%) Query: 4 EELIAIRRDLHRIPELGFQEFKTQQYLLNVLEQYPQDRIEIEKWRTGLFVKVNGTA--PE 61 + ++ +R +HR PEL E+KTQQ + +LE++ + TGL++ + G+A P+ Sbjct: 16 DAVLELRHAMHREPELSNNEWKTQQRIRGMLERFGLKGATVFH-NTGLYIDIEGSASGPK 74 Query: 62 KMLAYRADIDALSIEE-QTGLPFASEHHGNMHACGHDLHMTIALGII--DHFVHHPVKHD 118 + +A R DIDAL I+E + LP+ S G MHACGHDLH +IA+G+ H + + Sbjct: 75 RAVAVRGDIDALPIQETRDDLPYQSHVEGVMHACGHDLHASIAMGVALAFHRMRNNFAGK 134 Query: 119 LLFLFQPAEEG-PGGAEPMLESDVLKKWQPDFITALHIAPELPVGTIATKSGLLFANTSE 177 L FQPAEE P G +LE +L+ + D H+ P + VG + G + ++ + Sbjct: 135 LRVFFQPAEEAEPLGGRTVLEERLLEGF--DNAVGFHVTPSIQVGKFGAREGAVSKSSDQ 192 Query: 178 LVIDLEGKGGHAAYPHLAEDMVVAASTLVTQLQTIISRNTDPLDSAVITVGTITGGSAQN 237 + + G H + PH D + A+ V ++Q +ISR D +VIT+GTI GG A N Sbjct: 193 FKVTVSGSAAHGSTPHNGIDAITIAAAFVNEVQKVISREVPVDDRSVITIGTIHGGEATN 252 Query: 238 IIAETAHLEGTIRTLSEESMKQVKERIEDVVKGIEIGFRCKGKVTYPSVYHQVYNTSGLT 297 II +EGTIRT + E + +R+ ++ +G+ R K +V S V N + Sbjct: 253 IICPKVVMEGTIRTTNPELRPLLSQRVREIAEGVAALHRGKAEVVVTSGEPAVINDPEMV 312 Query: 298 EEFMSFVAEHQLATVIEAKEAMTG-EDFGYMLKKYPGFMFWLGA---DSEHGLH 347 F V++ + + +A++G +DFG+ + P FW G+ +E G+H Sbjct: 313 RLFRDAVSDMAGSDALTQGKAISGSDDFGFYSQCIPSIYFWFGSGEPGNESGVH 366 Lambda K H 0.319 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 398 Length adjustment: 30 Effective length of query: 344 Effective length of database: 368 Effective search space: 126592 Effective search space used: 126592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory