Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_012386429.1 BIND_RS17910 alanine--glyoxylate aminotransferase family protein
Query= BRENDA::P74281 (384 letters) >NCBI__GCF_000019845.1:WP_012386429.1 Length = 398 Score = 266 bits (681), Expect = 6e-76 Identities = 142/364 (39%), Positives = 224/364 (61%), Gaps = 3/364 (0%) Query: 4 KQMLMIPGPTPVPEKVLLAMAKHPIGHRSGDFSKIIAELTANLKWLHQTENDVLMLTTSG 63 + L IPGP+PVPE++L A++ I HR +F + E+ A + + +T V++ +SG Sbjct: 7 RHFLQIPGPSPVPERILRALSMQVIDHRGPEFGALGREVLAGCQTIFKTSGPVVIYPSSG 66 Query: 64 TGAMEASIINFLSPGDRVLVGNNGKFGDRWVKVAKTFGLAVEEIKAEWGKALDPNDFKTL 123 TGA EA+I+N LSPGD+VL+ G F W K+A +GL V+ + +W DP + Sbjct: 67 TGAWEAAIVNTLSPGDKVLMVETGHFATLWRKMAGRWGLDVDFLAGDWRHGADPAAIEAK 126 Query: 124 LEADSDKTIKALIITHSETSTGVLNDLAAINAAA-KAHGGALMIVDAVTSLGATPVAIDD 182 L D K+IKA+++ H+ETSTGV++ +A I A KA+ AL++VD ++SLG+ ++ Sbjct: 127 LAEDKPKSIKAVMVVHNETSTGVISRIAEIRKAIDKANHPALLMVDTISSLGSADYRHEE 186 Query: 183 LGLDVVASGSQKGYMIPPGLGFVSVSAKAWQAYETATIPRFYLDLKKYKKSTDEDSSPFT 242 G+DV S SQKG M+PPGLGF ++S KA A +T +PR Y D ++ K P+T Sbjct: 187 WGVDVTVSCSQKGLMLPPGLGFTAISDKALAASKTNKMPRSYWDWEEMLKPNANGFFPYT 246 Query: 243 PPINLMYGLQASLQMMKAEGLDAIFTRHQRHTNATRGAMKALNLPLFAPDNAA-SNAITA 301 P NL+YGL+ +++++ EGLD +F RHQ ATR A++A L + + A S +TA Sbjct: 247 PATNLLYGLREAIKILLEEGLDTVFARHQHLAAATRAAVRAWGLEILCLEPAEYSPVLTA 306 Query: 302 V-APLGVEAEKIRSTMRKKFDIAMAGGQDHLKGKIFRIGHLGFVCDRDILSCIGALEATL 360 + P G +A++ R+ + +K+++++ G +L GK+FRIGHLG + ++ +G +E L Sbjct: 307 ILMPQGHDADQFRALVLEKYNMSLGAGLTNLAGKVFRIGHLGECNELTLIGTLGGVEMGL 366 Query: 361 IELG 364 G Sbjct: 367 AAAG 370 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 398 Length adjustment: 31 Effective length of query: 353 Effective length of database: 367 Effective search space: 129551 Effective search space used: 129551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory