Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_012411258.1 NPUN_RS25070 aspartate aminotransferase family protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >NCBI__GCF_000020025.1:WP_012411258.1 Length = 427 Score = 338 bits (868), Expect = 1e-97 Identities = 181/405 (44%), Positives = 247/405 (60%), Gaps = 8/405 (1%) Query: 2 SVEHAAVERADFDQVMVPNYAPAAFIPVRGAGSRVWDQSGRELIDFAGGIAVNVLGHAHP 61 SV + + F++ ++ Y RGAG RVWD GRE +DF GIA LGHAHP Sbjct: 18 SVASSPFDADSFNEAVMSTYGRFPLALERGAGCRVWDTQGREYLDFVAGIATCTLGHAHP 77 Query: 62 ALVAALTEQANKLWHVSNVFTNEPALRLAHKLVDATFAERVFFCNSGAEANEAAFKLARR 121 +V A+T Q KL HVSN++ LA LV+ + A+RVFFCNSGAEANEAA KLAR+ Sbjct: 78 VMVEAVTRQIQKLHHVSNLYYIPEQGELAKWLVEHSCADRVFFCNSGAEANEAAIKLARK 137 Query: 122 VAHDRFGTEKYEIVAALNSFHGRTLFTVNVGGQSKYSDGFGPKITGITHVPYNDLAALKA 181 AH EK I+ A SFHGRTL T+ Q KY F P + G +V YND+ A++ Sbjct: 138 YAHTVLDIEKPIILTANASFHGRTLATITATAQPKYQKYFDPLVPGFHYVNYNDINAVEV 197 Query: 182 AVSD------KTCAVVLEPIQGEGGVLPAELSYLQGARELCDAHNALLVFDEVQTGMGRS 235 A+S+ + A+++EP+QGEGGV P +++Y + R++CD LL+FDEVQ GMGRS Sbjct: 198 AISELDEGDYRVAAILIEPLQGEGGVRPGDVAYFKKLRQICDETGILLIFDEVQVGMGRS 257 Query: 236 GKLFAYQHYGVTPDILTSAKSLGGGFPIAAMLTTEDLAKHLVVGTHGTTYGGNPLACAVA 295 GKL+AY+H GV PDI TSAK LGGG PI AM+ ++ G H +T+GGNP C VA Sbjct: 258 GKLWAYEHLGVEPDIFTSAKGLGGGIPIGAMM-SKKFCDVFQPGEHASTFGGNPFVCGVA 316 Query: 296 EAVIDVINTPEVLNGVNAKHDKFKTRLEQIGEKY-GLFTEVRGLGLLLGCVLSDAWKGKA 354 +V + +L V + ++ ++ L I KY EVRG GL+ G L + A Sbjct: 317 LSVCQTLERENILQNVQDRGEQLRSGLRAIAAKYPQQIGEVRGWGLINGLELRADIQLTA 376 Query: 355 KDIFNAAEREGLMILQAGPDVIRFAPSLVVEDADIDAGLDRFERA 399 DI NAA EG++++ AGP V+RF P L+V +A+++ L+ ++A Sbjct: 377 ADIVNAAINEGVLLVPAGPKVVRFVPPLIVTEAEVNTALEAVDKA 421 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 427 Length adjustment: 31 Effective length of query: 375 Effective length of database: 396 Effective search space: 148500 Effective search space used: 148500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory