Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_012409247.1 NPUN_RS13710 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_000020025.1:WP_012409247.1 Length = 273 Score = 182 bits (461), Expect = 9e-51 Identities = 100/269 (37%), Positives = 155/269 (57%), Gaps = 11/269 (4%) Query: 1 MTKDN----ASLARLTDVIDRLLAPEG-CPWDKEQTPESLCDYLVEECFELVEAIRSGNA 55 MT D A+L L +V+ +L +P+G CPWD QT E+L Y++EE +E+V+AI+SG+ Sbjct: 1 MTSDKVETLAALQELIEVVAKLRSPDGGCPWDLAQTAETLTPYVIEEAYEVVDAIKSGDQ 60 Query: 56 DEVREEMGDVMFLLAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFL 115 + EE+GD++ + ++ ++ G F+L + + K+IRRHPHVF D + A DE Sbjct: 61 KAIAEELGDLLLQVVLQAQIASESGQFSLKEITQGISQKLIRRHPHVFGDVSVASVDEVR 120 Query: 116 RNWESIKRAEKADAEGEPQGVYDSL---PASLPPLLKAYRIHSKAARVGFTWPEDEDVER 172 +NWE IK EK + + Q + L +LPPL A +I KAA +GF W + V Sbjct: 121 QNWEQIKAQEKGEPSPDAQKLSAKLGRYGRTLPPLTAAMKISQKAAAIGFEWENIQGVWD 180 Query: 173 QVEAEWLELLDVLAGDDKAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRR 232 + E E LA + A Q+ ELGDL+F++++L R + + L TN +F++R + Sbjct: 181 KFHEELGEFQQALAEETPARQQAELGDLLFAVIQLARWHNLDPSAGLQGTNQRFVQRLEK 240 Query: 233 MEALARERGLDFPALSLDDKDELWNEAKA 261 MEA+ D+ SLD+ + LW +AKA Sbjct: 241 MEAVCDRPLSDY---SLDELENLWQQAKA 266 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 273 Length adjustment: 25 Effective length of query: 242 Effective length of database: 248 Effective search space: 60016 Effective search space used: 60016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory