Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate WP_012411258.1 NPUN_RS25070 aspartate aminotransferase family protein
Query= SwissProt::Q88FI7 (416 letters) >NCBI__GCF_000020025.1:WP_012411258.1 Length = 427 Score = 192 bits (487), Expect = 2e-53 Identities = 138/416 (33%), Positives = 213/416 (51%), Gaps = 50/416 (12%) Query: 15 PITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPH 74 P+ L G VWDT G+ Y+DFV GI LGH +P +VEA+ Q +L H + + Sbjct: 41 PLALERGAGCRVWDTQGREYLDFVAGIATCTLGHAHPVMVEAVTRQIQKLHHVS-----N 95 Query: 75 GPYLALMEQLSQFVPVSYPLAGML--TNSGAEAAENALKVARGATG------KRAIIAFD 126 Y+ +L++++ V + A + NSGAEA E A+K+AR K I+ + Sbjct: 96 LYYIPEQGELAKWL-VEHSCADRVFFCNSGAEANEAAIKLARKYAHTVLDIEKPIILTAN 154 Query: 127 GGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVEL 186 FHGRTLAT+ + P Q+ + P +H Y + + E A+ +D Sbjct: 155 ASFHGRTLATITATAQ--PKYQKYFDPLVPGFH--YVNYNDINAVEVAISELDE------ 204 Query: 187 AVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFP 246 VAA + EP+QGEGG D A+ + LR+ CDE GIL+I DE+Q G GR+G+ +A+ Sbjct: 205 GDYRVAAILIEPLQGEGGVRPGDVAYFKKLRQICDETGILLIFDEVQVGMGRSGKLWAYE 264 Query: 247 RLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQM 306 LG+EPD+ AK + GG+P+GA++ +K P G T+ GNP C AL+ + Sbjct: 265 HLGVEPDIFTSAKGLGGGIPIGAMMSKKFCDVFQP-GEHASTFGGNPFVCGVALSVCQTL 323 Query: 307 TDEN-LATWGERQEQ------AIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANADGSP 359 EN L +R EQ AI ++Y + IG + G G + G+E Sbjct: 324 ERENILQNVQDRGEQLRSGLRAIAAKYPQ--------QIGEVRGWGLINGLELR------ 369 Query: 360 APAQL--AKVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLA 413 A QL A ++ AA G+LL+P+G ++R + PL + + L+ +++ ++ Sbjct: 370 ADIQLTAADIVNAAINEGVLLVPAGP--KVVRFVPPLIVTEAEVNTALEAVDKAMS 423 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 427 Length adjustment: 32 Effective length of query: 384 Effective length of database: 395 Effective search space: 151680 Effective search space used: 151680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory