Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate WP_012403900.1 BPHY_RS23215 4-aminobutyrate--2-oxoglutarate transaminase
Query= SwissProt::Q5JEW1 (445 letters) >NCBI__GCF_000020045.1:WP_012403900.1 Length = 427 Score = 271 bits (692), Expect = 4e-77 Identities = 158/405 (39%), Positives = 227/405 (56%), Gaps = 17/405 (4%) Query: 42 RGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFYENAII 101 R E ++DV+G F DFA+G+ V N GH HP++VEA++ Q + FTH + Y + + Sbjct: 28 RAENAELWDVEGRRFIDFAAGIAVCNTGHRHPKIVEAVRAQLDHFTHTAYQIVPYASYVE 87 Query: 102 LAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGRTQAVLSL 161 LAEK+ E APGD +K + +GAEA E A+K+ + TGR +AF FHGRT ++L Sbjct: 88 LAEKINERAPGDYPKKTAFFTTGAEAVENAIKIARAFTGRPGVIAFTGGFHGRTMMGMAL 147 Query: 162 TASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIEEYVFRHVPP 221 T + F P V H P+PNP + G D L + ++F+ + + P Sbjct: 148 TGKVAPYKLNFGPFPADVFHAPFPNP------LHGVTTADSL--KAIEFLFK---ADIDP 196 Query: 222 HEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIGRTGKFWAIEHF 281 + AI FEP+QGEGG+ P F +AL+K +E+GILL DEVQ G RTGK +A+ H+ Sbjct: 197 KRVAAIIFEPVQGEGGFYPAPAEFVRALRKLCNEHGILLIADEVQTGFARTGKLFAMNHY 256 Query: 282 GVEPDLIQFGKAIGGGLPLAGVIHRADI-TFDKPGRHATTFGGNPVAIAAGIEVVEIVKE 340 V PDL+ K++ GG+PL+GV+ RAD+ PG T+ GNP+A+A+ V++I+ E Sbjct: 257 DVVPDLMTMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGNPLAVASAHAVLDIIDE 316 Query: 341 --LLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEIVKSKETKEKYPELRDRIV 398 L +GD L L + + +I D RG G AVE K T E + R+ Sbjct: 317 ERLCERAVVLGDRLKAKLTALQSEVPLIADVRGPGGMVAVEFCK-PGTSEADADFTKRVQ 375 Query: 399 KESAKRGLVLLGCG--DNSIRFIPPLIVTKEEIDVAMEIFEEALK 441 + +RGL+LL CG N +RF+ PL + D A+ I EE LK Sbjct: 376 TRALERGLLLLVCGVYSNVVRFLFPLTIQDSVFDEAVSILEEVLK 420 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 427 Length adjustment: 32 Effective length of query: 413 Effective length of database: 395 Effective search space: 163135 Effective search space used: 163135 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory