Align Aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79 (characterized)
to candidate WP_012401370.1 BPHY_RS10105 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::Q82WA8 (397 letters) >NCBI__GCF_000020045.1:WP_012401370.1 Length = 396 Score = 174 bits (442), Expect = 3e-48 Identities = 113/371 (30%), Positives = 186/371 (50%), Gaps = 20/371 (5%) Query: 30 KNIIGLGAGEPDFDTPLHIKDAAITAIRNGFTKYTAVGGTASLKQAIISKFKRENSLEF- 88 KN + LG G PDFD I DA A+R G +Y + G A L+QAI K + Sbjct: 41 KNAVNLGQGFPDFDCDPRIVDAVSNAMREGHNQYPPMAGVAPLRQAISEKISSLYGRRYD 100 Query: 89 MPGEILVSSGGKQSFFNLVLATIDPGDEVIIPAPYWVSYPDIVLIAEGKPVFIDTGIEEK 148 EI V++G Q+ +L + PGDEVI+ P + SY + +A GKPVF+ + Sbjct: 101 ATTEITVTAGATQALLTAILCAVHPGDEVIVVEPTYDSYLPSIELAGGKPVFVTLDAPD- 159 Query: 149 FKISPDQLEKAITPRTRMFVVNSPSNPSGSVYSLEELQALGAVLRKYPDILIATDDMYEH 208 + I D+L AITPRTRM ++N+P NP+G+V+ E+++ L ++R ++LI +D++YEH Sbjct: 160 YAIPFDKLAAAITPRTRMILINTPHNPTGTVWRAEDMKKLEDIVRG-TNVLILSDEVYEH 218 Query: 209 ILLSGDGFVNILNACPDLKARTVVLNGVSKAYAMTGWRIGYCGGPAAIITAMENIQSQST 268 ++ G ++ P+L R+ V++ K Y +TGW++GY PAA++ + + Sbjct: 219 MVYDGAPHESVAR-YPELAQRSFVVSSFGKTYHVTGWKVGYVAAPAALMAEFRKVHQFNV 277 Query: 269 SNPNSIAQVAAEAALNGDQSCMVPMIEAFRERNQFLTNALNSIAGIHCLLSEGAFYAFVD 328 N+ Q+ + + + AF ++ + A + + L G ++ VD Sbjct: 278 FTVNTPMQLGLAHYMQDPAPYL--NLPAFYQKKRDFFRAGLAQSRFKLLPCTGTYFQCVD 335 Query: 329 VRQAISRLNTQQILQNSSDIAFCNYVLEKAEVAAVPGSAFGCE----GYMRLSFATSMDN 384 + + + F ++ + VAA+P SAF E G +R FA D Sbjct: 336 ----------YSAISDMPEAEFAQWLTSEIGVAAIPVSAFYHERHESGVVRFCFAKKEDT 385 Query: 385 LQEAVKRIASL 395 L A++R+A L Sbjct: 386 LATALERLARL 396 Lambda K H 0.318 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 396 Length adjustment: 31 Effective length of query: 366 Effective length of database: 365 Effective search space: 133590 Effective search space used: 133590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory