Align Imidazole glycerol phosphate synthase subunit HisF; EC 4.3.2.10; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF (uncharacterized)
to candidate WP_012469092.1 GLOV_RS05020 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
Query= curated2:A4YI34 (251 letters) >NCBI__GCF_000020385.1:WP_012469092.1 Length = 245 Score = 121 bits (303), Expect = 2e-32 Identities = 80/243 (32%), Positives = 121/243 (49%), Gaps = 10/243 (4%) Query: 6 IIACLDVKDGKVVK---GVRFLDLKLKGDPAELASRYEEEGADEIVFLDISATVEGRKTL 62 +I +D+K+G V+ G D +PAE A +++E GA+ + +D+ G Sbjct: 3 VIPAIDLKEGNCVRLEQGEMNRDTVFSDNPAEQALKWQEAGAELLHLVDLDGAFAGIPKN 62 Query: 63 LEKVRETASVLSIPLTVGGGVRTVEDVSNLLSNGADKVSLNTVAAENPSVVSMASREFGA 122 + ++IP +GGG+R + + LS G +V + T A NP +V A ++F Sbjct: 63 KAAIEAIIKAITIPAQLGGGIRDIATIEAYLSLGLSRVIIGTAAQRNPELVIEACQKFPG 122 Query: 123 QAVVVAIDAKRVGNGWRVFVRSGTKDTGLDAVDWAKRVEEMGAGEILLTSIDRDGTRDGY 182 + +VV IDAK NG V V+ + T + AVD AK+ E+ G I+ T I RDG G Sbjct: 123 R-IVVGIDAK---NGM-VAVQGWAELTDISAVDLAKKFEDCGVAAIIYTDISRDGMMGGP 177 Query: 183 DLELTKAVVRATKVPVIASGGAG--KPDHFLSVFRQAGADAALAAGIFHDGVIRIRELKD 240 +LE T+A+ A +PVIASGG K L +G A+ + G I +RE D Sbjct: 178 NLEATRALAEAISIPVIASGGVSSLKDIENLMAIEASGVTGAITGKAIYTGAINLREAID 237 Query: 241 YLK 243 K Sbjct: 238 LTK 240 Lambda K H 0.317 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 245 Length adjustment: 24 Effective length of query: 227 Effective length of database: 221 Effective search space: 50167 Effective search space used: 50167 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory