Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_012469824.1 GLOV_RS08775 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_000020385.1:WP_012469824.1 Length = 399 Score = 254 bits (650), Expect = 2e-72 Identities = 151/375 (40%), Positives = 224/375 (59%), Gaps = 20/375 (5%) Query: 19 KFSNLVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTPNAGYLELRQAVQLYM 78 K L AQ DV+ G+PDF TP H++ A KKAID T Y P G +L+ A+ M Sbjct: 21 KAKALKAQGVDVVGFGAGEPDFDTPAHIREAGKKAIDAGFTRYMPVGGADDLKDAIIAKM 80 Query: 79 KKKADFNYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLCGAKPV 138 K+ + Y + EI + GA + + ++ GDEVI+PGP + Y I L G PV Sbjct: 81 KRDHNLEYTRD-EISVACGAKHTLYNISQALIQEGDEVIIPGPYWVSYPDQIVLAGGTPV 139 Query: 139 IVDTT-SHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIA-ALLKGRNVF 196 + T S GFK+T ++ A+TP T+ ++L P NPTG T S+EEL ++ LLK +V Sbjct: 140 FIMTDESTGFKITPEQLDKAITPKTRYLILNSPCNPTGSTYSKEELAALGEVLLKHEHVL 199 Query: 197 VLSDEIYSELTYDR-PHYSIATY---LRDQTIVINGLSKSHSMTGWRIGFLFAPKDIAKH 252 V++D+IY L YD Y+IA L+ +TIV+NG+SK+++MTGWRIG+ PK++ Sbjct: 200 VVADDIYERLIYDGLSFYNIAQVVPALKSRTIVVNGVSKTYAMTGWRIGYACGPKELMAA 259 Query: 253 ILKVHQYNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLDYVYDRLVSM-GLDVVKP 311 + K+ + S A+SI+QKA++EA+ + M +++KR Y+ +RL +M G+ K Sbjct: 260 MTKMQSQSTSNATSIAQKASVEALNGPQEPVAAMCVEFEKRRTYIVERLNAMPGVSCFKS 319 Query: 312 SGAFYIFPSIKS-FGM---------TSFDFSMALLEDAGVALVPGSSFSTYGEGYVRLSF 361 +GAFY+FP+ +G TS DF+ LLEDA VALVPG +F + Y RLS+ Sbjct: 320 NGAFYVFPNFSGVYGKTTPGGKKIETSSDFAAYLLEDAKVALVPGVAFG--DDRYARLSY 377 Query: 362 ACSMDTLREGLDRLE 376 A SM+ +++G+DR+E Sbjct: 378 AISMENIKKGMDRIE 392 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 26 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 399 Length adjustment: 31 Effective length of query: 362 Effective length of database: 368 Effective search space: 133216 Effective search space used: 133216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory