Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_012470204.1 GLOV_RS10655 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000020385.1:WP_012470204.1 Length = 358 Score = 317 bits (811), Expect = 4e-91 Identities = 159/363 (43%), Positives = 238/363 (65%), Gaps = 6/363 (1%) Query: 1 MSEADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWV 60 M + L+ LR ID +D R+++L+++RAR A +V R+K ++ F+ P RE V Sbjct: 1 MPKNQSLEQLRGEIDQIDSRLVELLNQRARVASDVGRLKAG-----QDRDFHVPSREREV 55 Query: 61 LKHIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVI 120 + + +N+GPL E + +FREIMS+CL+LE PL+VAY+GP+ TFS A ++ FG S Sbjct: 56 HERVARMNQGPLPEEALHSIFREIMSACLSLESPLKVAYMGPKATFSHLATMQQFGLSAQ 115 Query: 121 SKPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHL 180 +P +I VF EV G +GVVPVENSTEG V HTLD F++ ++ I E+ L IHH L Sbjct: 116 LEPQKSIPAVFEEVEKGKALYGVVPVENSTEGVVTHTLDMFVDSNLQIISEIILDIHHDL 175 Query: 181 LVGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIA 240 L T + + I ++YSH Q +AQCR WL+ + PNV V V+S A AA+ V ++ +AAIA Sbjct: 176 L-SRTGRLEDIRKVYSHPQPIAQCRHWLEENLPNVPLVDVASTAVAAQIVSEDYTAAAIA 234 Query: 241 GDMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELL 300 ++AA +Y L + +IED+ N TRFL+I + PTG+DKTSI+ S+R++PG L+ +L Sbjct: 235 SELAASMYDLKMVRSRIEDQVNNVTRFLVISRKPAEPTGNDKTSIMFSVRDEPGILYRML 294 Query: 301 MPFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSY 360 PF G++L++IE+RP ++ W Y+FF+D GH + ++ ++++ LK+LGSY Sbjct: 295 EPFARRGVNLSKIESRPVKTKAWEYIFFLDMSGHVSEAPVREAIDELKSFCQFLKILGSY 354 Query: 361 PKA 363 PKA Sbjct: 355 PKA 357 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 358 Length adjustment: 29 Effective length of query: 336 Effective length of database: 329 Effective search space: 110544 Effective search space used: 110544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_012470204.1 GLOV_RS10655 (prephenate dehydratase)
to HMM PF01817 (CM_2)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF01817.25.hmm # target sequence database: /tmp/gapView.687937.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-25 75.2 0.1 4.4e-25 74.2 0.1 1.6 1 NCBI__GCF_000020385.1:WP_012470204.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000020385.1:WP_012470204.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.2 0.1 4.4e-25 4.4e-25 1 78 [. 11 87 .. 11 88 .. 0.95 Alignments for each domain: == domain 1 score: 74.2 bits; conditional E-value: 4.4e-25 CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlre...gaeelgldpeavekifreiis 72 R eId+iD++l+eLl++R+++a +++++K+ ++ ++ p+Re+ev er+++ g+ l++ea+ +ifrei+s NCBI__GCF_000020385.1:WP_012470204.1 11 RGEIDQIDSRLVELLNQRARVASDVGRLKAGQDRDFHVPSREREVHERVARmnqGP----LPEEALHSIFREIMS 81 89*************************************************66555....*************** PP CM_2 73 esralQ 78 ++++l+ NCBI__GCF_000020385.1:WP_012470204.1 82 ACLSLE 87 ***998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (79 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 3.69 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory