Align Cyclohexadienyl dehydrogenase; Arogenate dehydrogenase; ADH; Prephenate dehydrogenase; PDH; EC 1.3.1.43; EC 1.3.1.12 (characterized)
to candidate WP_012470203.1 GLOV_RS10650 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= SwissProt::Q04983 (293 letters) >NCBI__GCF_000020385.1:WP_012470203.1 Length = 288 Score = 192 bits (487), Expect = 1e-53 Identities = 111/281 (39%), Positives = 155/281 (55%), Gaps = 2/281 (0%) Query: 3 VFKHIAIIGLGLIGSSAARATKAYCPDVTVSLYDKSEFVRDRARALNLGDNVTDDIQDAV 62 V A+IG+GLIG S +RA K V +D A L + D + D AV Sbjct: 5 VINTFAVIGVGLIGGSFSRALKQAGVVKRVIGFDLDSANLAEALQLGVVDEIAADYAAAV 64 Query: 63 READLVLLCVPVRAMGIVAAAMAPALKKDVIICDTGSVKVSVIKTLQDNLP-NHIIVPSH 121 ADLV L VPVRAM +A AP L+ ++ D GSVK ++ + +P V H Sbjct: 65 SSADLVFLAVPVRAMTAAVSACAPFLRPGCVVTDGGSVKDELVVACEQLVPAGCFFVGGH 124 Query: 122 PLAGTENNGPDAGFAELFQDHPVILTPDAHTPAQAIAYIADYWEEIGGRINLMSAEHHDH 181 P+AGTE++G A FA L+Q ILTP + T QA+ + WE G R+ M HD Sbjct: 125 PIAGTEHSGAKASFATLYQGRRCILTPTSRTDQQALDLVQRLWEAAGSRVECMEPLTHDR 184 Query: 182 VLALTSHLPHVIAYQLIGMVSGYEKKSRTPIMRYSAGSFRDATRVAASEPRLWQDIMLEN 241 V A SHLPH++AY L+ V+G ++ I+ +SAG FRD TR+A+S+P +W+DI L N Sbjct: 185 VFAAVSHLPHMVAYALVHAVNGSAEEEEN-ILAFSAGGFRDFTRIASSDPSMWRDIALMN 243 Query: 242 APALLPVLDHFIADLKKLRTAIASQDGDYLLEHFKESQKAR 282 LL +LD + ++ LR +AS DG +L +F S++ R Sbjct: 244 RLPLLAMLDRYQSEFAALRERVASGDGAWLENYFTTSKRLR 284 Lambda K H 0.321 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 288 Length adjustment: 26 Effective length of query: 267 Effective length of database: 262 Effective search space: 69954 Effective search space used: 69954 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory