Align Aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79 (characterized)
to candidate WP_012469824.1 GLOV_RS08775 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::A3PMF8 (400 letters) >NCBI__GCF_000020385.1:WP_012469824.1 Length = 399 Score = 405 bits (1041), Expect = e-117 Identities = 204/390 (52%), Positives = 269/390 (68%) Query: 4 LSDTLARVKPSQTIAVTNKARELAAAGRDVIGLGAGEPDFDTPDNIKAAAKRAIDAGRTK 63 L+D + +++PS T+A+ KA+ L A G DV+G GAGEPDFDTP +I+ A K+AIDAG T+ Sbjct: 3 LADRVNKIQPSPTLAIDAKAKALKAQGVDVVGFGAGEPDFDTPAHIREAGKKAIDAGFTR 62 Query: 64 YTAVDGIPELKRAICEKFERENGLKYTPAQVTVGTGGKQILYNALVATLNPGDEVIIPAP 123 Y V G +LK AI K +R++ L+YT +++V G K LYN A + GDEVIIP P Sbjct: 63 YMPVGGADDLKDAIIAKMKRDHNLEYTRDEISVACGAKHTLYNISQALIQEGDEVIIPGP 122 Query: 124 YWVSYPDMVLLAGGTPVSVAAGMETGFKLTPEQLEAAITPRTKWFIFNSPSNPTGAAYTR 183 YWVSYPD ++LAGGTPV + TGFK+TPEQL+ AITP+T++ I NSP NPTG+ Y++ Sbjct: 123 YWVSYPDQIVLAGGTPVFIMTDESTGFKITPEQLDKAITPKTRYLILNSPCNPTGSTYSK 182 Query: 184 AELAALCEVLMRHPQVWIMSDDMYEHLVFDDFDFTTPAQIEPGLYDRTLTCNGVSKAYCM 243 ELAAL EVL++H V +++DD+YE L++D F AQ+ P L RT+ NGVSK Y M Sbjct: 183 EELAALGEVLLKHEHVLVVADDIYERLIYDGLSFYNIAQVVPALKSRTIVVNGVSKTYAM 242 Query: 244 TGWRIGYAAGPVELIRAMGTIQSQSTSNPCSIAQYAALEALSGPQEFLATNREAFQRRRD 303 TGWRIGYA GP EL+ AM +QSQSTSN SIAQ A++EAL+GPQE +A F++RR Sbjct: 243 TGWRIGYACGPKELMAAMTKMQSQSTSNATSIAQKASVEALNGPQEPVAAMCVEFEKRRT 302 Query: 304 LVVSMLNEAKGVTCPNPEGAFYVYPDISGCIGKTSAGGAKITDDEAFASALLEETGVAVV 363 +V LN GV+C GAFYV+P+ SG GKT+ GG KI FA+ LLE+ VA+V Sbjct: 303 YIVERLNAMPGVSCFKSNGAFYVFPNFSGVYGKTTPGGKKIETSSDFAAYLLEDAKVALV 362 Query: 364 FGAAFGLSPNFRISYATADEVLREACARIQ 393 G AFG R+SYA + E +++ RI+ Sbjct: 363 PGVAFGDDRYARLSYAISMENIKKGMDRIE 392 Lambda K H 0.318 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 478 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 399 Length adjustment: 31 Effective length of query: 369 Effective length of database: 368 Effective search space: 135792 Effective search space used: 135792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory