Align Shikimate kinase; SK; EC 2.7.1.71 (uncharacterized)
to candidate WP_012465901.1 CLIM_RS04760 shikimate kinase
Query= curated2:B3QMM3 (187 letters) >NCBI__GCF_000020465.1:WP_012465901.1 Length = 199 Score = 254 bits (650), Expect = 5e-73 Identities = 129/185 (69%), Positives = 153/185 (82%) Query: 1 MKHHSLIFLTGFSGSGKSTIGPLLANSLGFEFIDLDREIELAAGKSINRIFAEDGEAAFR 60 MKHHSLIFLTGFSGSGKSTIGPLLANSLG+ FIDLD+EIE AGKSI +IFAE+GE FR Sbjct: 1 MKHHSLIFLTGFSGSGKSTIGPLLANSLGYGFIDLDQEIESKAGKSITKIFAEEGEQTFR 60 Query: 61 ELELRTLERIGSQKEMVVSLGGGVLENDRCFELIRRTGTLVYMKSSPEILSLRLQHKTDR 120 LEL TL ++ +KE+VVSLGGGVLEN+ C+ LIR GTLVY+KSSP L+ RL +KTDR Sbjct: 61 NLELETLRQLTGKKELVVSLGGGVLENNDCYRLIRENGTLVYLKSSPRSLARRLCNKTDR 120 Query: 121 PLLKGPNGEKLSREQVEQRISEILEKREPRYQKADLIIVTDSKKIGSTVEEMTRKIERHI 180 PLLKG +G +LSRE++E +IS ILEKREPRY ADL + TD K+IGSTVEE+TR I R + Sbjct: 121 PLLKGEHGTRLSREEIELKISTILEKREPRYATADLSVQTDIKRIGSTVEELTRTIIRFV 180 Query: 181 RRVER 185 R+ E+ Sbjct: 181 RQAEQ 185 Lambda K H 0.317 0.137 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 187 Length of database: 199 Length adjustment: 20 Effective length of query: 167 Effective length of database: 179 Effective search space: 29893 Effective search space used: 29893 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory