Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate WP_012466828.1 CLIM_RS09680 class I fructose-bisphosphate aldolase
Query= BRENDA::Q8L207 (343 letters) >NCBI__GCF_000020465.1:WP_012466828.1 Length = 338 Score = 364 bits (935), Expect = e-105 Identities = 198/339 (58%), Positives = 234/339 (69%), Gaps = 5/339 (1%) Query: 2 NERLEDIALTLVGAGKGILAADESTATIGKRFESIGVECTEDNRRAYREMLFTAKEAMES 61 N+RL +A +V KG+LAADES TI KRF+S+GVE TE+NRR YRE+LFT +E Sbjct: 3 NDRLRSVANAIVTREKGVLAADESAPTIRKRFDSVGVESTEENRRRYREILFTTA-GIER 61 Query: 62 AISGVILFDETLRQKASTGQMLTDLIRDAGAVPGIKVDTGAKPLAAFPQETITEGLDGLR 121 I GVILFDETLRQ G L+ D G +PGIKVD GA+ LA +P E I EGLDGLR Sbjct: 62 HIGGVILFDETLRQSTRDGTPFARLLSDRGIIPGIKVDKGARELALYPGEKIAEGLDGLR 121 Query: 122 ERLKDYYTLGARFAKWRAVIAIDAQTLPTRGAISQNAQALARYAALCQEAGLVPIVEPEV 181 ERL +Y LGA FAKWRAVI ID +P+ I NA ALARYAALCQE +VPIVEPEV Sbjct: 122 ERLVEYRQLGAEFAKWRAVIEIDGHDMPSPFGIRANAHALARYAALCQELDIVPIVEPEV 181 Query: 182 LMDGPSRQHSITRCFEVTKVVLHTVFKELFEARVLFEGMILKPNMVIDGKDA-RIASVEE 240 LMDG H I RC EVT VL VF EL RVLFEGM+LKPNMVI GK R +SVE+ Sbjct: 182 LMDG---AHGIDRCEEVTSGVLQAVFSELDAHRVLFEGMLLKPNMVIAGKRCDRCSSVEQ 238 Query: 241 VAEKTVHVLKQTVPAAVPGIAFLSGGQTDEEATAHLSAMNALGALPWKLTFSYGRALQAA 300 VAE T+ + + VPAAVPGI FLSGGQ+ E+AT HL+AMN +G PW+++FSYGRALQA Sbjct: 239 VAEATIRCMTRYVPAAVPGIVFLSGGQSAEDATDHLNAMNRMGPHPWQVSFSYGRALQAP 298 Query: 301 ALKAWAGKNENIVVAQKAFCHRARMNHLAALGQWTKDQE 339 L AW G N+ A+ A R +N LA G++ + E Sbjct: 299 VLAAWKGDESNLESARHALAKRCLLNGLARQGKYARYME 337 Lambda K H 0.319 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 338 Length adjustment: 28 Effective length of query: 315 Effective length of database: 310 Effective search space: 97650 Effective search space used: 97650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory