Align Shikimate kinase; SK; EC 2.7.1.71 (uncharacterized)
to candidate WP_012504720.1 PAES_RS00600 ATP-dependent zinc metalloprotease FtsH
Query= curated2:Q2S9Q5 (192 letters) >NCBI__GCF_000020625.1:WP_012504720.1 Length = 699 Score = 37.0 bits (84), Expect = 8e-07 Identities = 34/109 (31%), Positives = 53/109 (48%), Gaps = 16/109 (14%) Query: 15 KAKKNVVLVGPMGTGKTTIGKLLAKELQFEF--VDSDREIEARCGADIPWIFDVEGEVGF 72 K K V+LVGP GTGKT + K +A E F + +E G + D+ F Sbjct: 228 KLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRDL-----F 282 Query: 73 R-GREKS-VIADLSQRDAVVIATGGGAVVDPD-------NQIALKENGF 112 R +EK+ I + + DAV + G GA++ + NQ+ ++ +GF Sbjct: 283 RQAKEKAPCIIFIDEIDAVGRSRGKGAMMGTNDERENTLNQLLVEMDGF 331 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 192 Length of database: 699 Length adjustment: 29 Effective length of query: 163 Effective length of database: 670 Effective search space: 109210 Effective search space used: 109210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory