Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate WP_012506546.1 PAES_RS09995 cysteine synthase A
Query= BRENDA::P9WP55 (310 letters) >NCBI__GCF_000020625.1:WP_012506546.1 Length = 308 Score = 394 bits (1012), Expect = e-114 Identities = 200/307 (65%), Positives = 239/307 (77%) Query: 1 MSIAEDITQLIGRTPLVRLRRVTDGAVADIVAKLEFFNPANSVKDRIGVAMLQAAEQAGL 60 M++ E IT+ +GRTPLVR+RR+ D + AD+ AKLE FNP +SVKDR+GVAM++ AE+ GL Sbjct: 1 MNVYESITETVGRTPLVRIRRMADHSYADVYAKLESFNPLSSVKDRVGVAMIEDAERNGL 60 Query: 61 IKPDTIILEPTSGNTGIALAMVCAARGYRCVLTMPETMSLERRMLLRAYGAELILTPGAD 120 I P+T I+EPTSGNTGIALA CA+RGYR +LTMP+TMS+ERR LL+ GAEL+LT GA Sbjct: 61 IGPETTIIEPTSGNTGIALAFSCASRGYRLILTMPDTMSVERRRLLKILGAELVLTEGAA 120 Query: 121 GMSGAIAKAEELAKTDQRYFVPQQFENPANPAIHRVTTAEEVWRDTDGKVDIVVAGVGTG 180 GM GAIA+AE L + + QQF NPANP HR TTA E+W DTDG+VDI +AGVGTG Sbjct: 121 GMKGAIAEAERLVDSIPHSLMLQQFNNPANPETHRRTTAREIWDDTDGQVDIFIAGVGTG 180 Query: 181 GTITGVAQVIKERKPSARFVAVEPAASPVLSGGQKGPHPIQGIGAGFVPPVLDQDLVDEI 240 GTITGV V++E KP VAVEP SPV+SGG+ GPH IQGIGAGFVP LD ++DEI Sbjct: 181 GTITGVGSVLRELKPGVHIVAVEPDDSPVISGGEPGPHKIQGIGAGFVPGNLDPSVIDEI 240 Query: 241 ITVGNEDALNVARRLAREEGLLVGISSGAATVAALQVARRPENAGKLIVVVLPDFGERYL 300 ITV N+DA AR+LAR+EG+L GISSGAA AA+ VA RP GK IVV+LPD GERYL Sbjct: 241 ITVSNQDAAETARKLARKEGILCGISSGAAMWAAMSVAARPAMEGKNIVVLLPDTGERYL 300 Query: 301 STPLFAD 307 ST LFAD Sbjct: 301 STWLFAD 307 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 308 Length adjustment: 27 Effective length of query: 283 Effective length of database: 281 Effective search space: 79523 Effective search space used: 79523 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_012506546.1 PAES_RS09995 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.3571670.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-143 462.4 0.0 3.6e-143 462.2 0.0 1.0 1 NCBI__GCF_000020625.1:WP_012506546.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000020625.1:WP_012506546.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 462.2 0.0 3.6e-143 3.6e-143 1 298 [] 7 305 .. 7 305 .. 0.99 Alignments for each domain: == domain 1 score: 462.2 bits; conditional E-value: 3.6e-143 TIGR01139 1 iseliGntPlvrLn.laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGial 72 i+e++G+tPlvr++ +a++ a+v++kles+nP ssvkdr+++amiedae++gl+ +++ti+e+tsGntGial NCBI__GCF_000020625.1:WP_012506546.1 7 ITETVGRTPLVRIRrMADHSYADVYAKLESFNPLSSVKDRVGVAMIEDAERNGLIGPETTIIEPTSGNTGIAL 79 6899**********8888899**************************************************** PP TIGR01139 73 amvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqfenpanp 145 a+ +a+rgy+liltmp+tms+err+llk +GaelvLt+ga gmkgai++ae lv++ p++ +l+qf+npanp NCBI__GCF_000020625.1:WP_012506546.1 80 AFSCASRGYRLILTMPDTMSVERRRLLKILGAELVLTEGAAGMKGAIAEAERLVDSIPHSL-MLQQFNNPANP 151 **********************************************************766.*********** PP TIGR01139 146 eihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsggkpgphkiqGig 218 e+hr+tta+ei+ d+dg++d+f+agvGtGGtitGvg+vl+e kp +++vaveP +spv+sgg+pgphkiqGig NCBI__GCF_000020625.1:WP_012506546.1 152 ETHRRTTAREIWDDTDGQVDIFIAGVGTGGTITGVGSVLRELKPGVHIVAVEPDDSPVISGGEPGPHKIQGIG 224 ************************************************************************* PP TIGR01139 219 agfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle.kdkkivvilpdtge 290 agf+P +Ld +vide+i+vs+++a etar+la++eGil GissGaa++aa+ va +++ ++k+ivv+lpdtge NCBI__GCF_000020625.1:WP_012506546.1 225 AGFVPGNLDPSVIDEIITVSNQDAAETARKLARKEGILCGISSGAAMWAAMSVAARPAmEGKNIVVLLPDTGE 297 *********************************************************99************** PP TIGR01139 291 rYlstaLf 298 rYlst Lf NCBI__GCF_000020625.1:WP_012506546.1 298 RYLSTWLF 305 *****998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (308 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 23.58 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory