Align Probable adenylyltransferase/sulfurtransferase MoeZ; EC 2.7.7.-; EC 2.8.1.- (characterized)
to candidate WP_012506392.1 PAES_RS09215 HesA/MoeB/ThiF family protein
Query= SwissProt::P9WMN7 (392 letters) >NCBI__GCF_000020625.1:WP_012506392.1 Length = 241 Score = 163 bits (413), Expect = 4e-45 Identities = 89/236 (37%), Positives = 135/236 (57%), Gaps = 6/236 (2%) Query: 22 RYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVDFDVVDESN 81 RYSR ++P +GV+GQ++L++A+VLVIGAGGLGAP LLYLAAAGVGTIG+ D D ++ SN Sbjct: 3 RYSRQQLVPVIGVEGQEKLRDAKVLVIGAGGLGAPVLLYLAAAGVGTIGVADGDRIEVSN 62 Query: 82 LQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELRLAPSNAVDLFKQYDLILDGTD 141 LQRQV++ D GR K A +++ A+NP + +R + + P +A L YD+++ +D Sbjct: 63 LQRQVLYRTCDAGRKKVDVAIEALKALNPDVDLRCYPQYVTPRDAGVLVHDYDIVVSASD 122 Query: 142 NFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAPDGLGVNYRDLYP-EPPPPGMV 200 +FA + ++NDA V P V G + +GQ YR + V Sbjct: 123 SFAAKLMINDACVCEAVPCVHGGVSGIDGQIMTTLPGT-----ACYRCAFNFTSRDASAV 177 Query: 201 PSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLLVYDALEMSYRTITIRK 256 + A+ G LG ++ E +K + G G L R+L++D E + T+ + K Sbjct: 178 ENFAQTGTLGPAAGVAGTLQAAEVMKYVCGYGTLLTDRILLFDLSESGFHTLPVMK 233 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 241 Length adjustment: 27 Effective length of query: 365 Effective length of database: 214 Effective search space: 78110 Effective search space used: 78110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory