Align Imidazole glycerol phosphate synthase subunit HisH; EC 4.3.2.10; IGP synthase glutaminase subunit; EC 3.5.1.2; IGP synthase subunit HisH; ImGP synthase subunit HisH; IGPS subunit HisH (uncharacterized)
to candidate WP_012536255.1 AFE_RS03015 glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit
Query= curated2:Q67KH8 (212 letters) >NCBI__GCF_000021485.1:WP_012536255.1 Length = 380 Score = 41.6 bits (96), Expect = 2e-08 Identities = 38/117 (32%), Positives = 53/117 (45%), Gaps = 18/117 (15%) Query: 4 IVIVDYGMGNLASVRNALRAVGFEAA-VSDDPAAVAGADGLVLPGVGA-FGTGMQNLARR 61 +V+ D+G + RN LR + A ++ PA A A+ + L G F G + A Sbjct: 191 VVVYDFG-----TKRNILRLLADRACRITVVPARTAAAEVIALRPDGILFSNGPGDPAAL 245 Query: 62 GL-DQAVRQAAAAGRPVLGICLGMQLL----------LAEGDEGGPRPGLGLLEGRV 107 G ++A+RQ A G P G+CLG QLL + G G P L GRV Sbjct: 246 GYAEEAMRQVIATGIPTFGLCLGHQLLGRALGAKTVKMKFGHHGANHPVKDLRSGRV 302 Lambda K H 0.321 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 380 Length adjustment: 26 Effective length of query: 186 Effective length of database: 354 Effective search space: 65844 Effective search space used: 65844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory