Align Prephenate dehydrogenase protein; EC 1.3.1.12 (characterized, see rationale)
to candidate WP_012536423.1 AFE_RS04225 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= uniprot:D8IR44_HERSS (295 letters) >NCBI__GCF_000021485.1:WP_012536423.1 Length = 291 Score = 181 bits (459), Expect = 2e-50 Identities = 105/284 (36%), Positives = 155/284 (54%), Gaps = 7/284 (2%) Query: 2 FKKVVIFGVGLIGGSFALALRRAGQAAHIVGVGRSLQSLERARELGIIDAVAT--DAASA 59 F+++VI G+GL+GGS A ALR G A +VGV Q++ R R ++ + A Sbjct: 6 FQRIVIVGLGLMGGSIAKALRSRGFAGSLVGVVVDAQAVRRLRSAAKYWRISLTCEPEPA 65 Query: 60 VQGADLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQFIP 119 ++ ADL+L+A P L + H+ +V+D S K+ V R LGDR FIP Sbjct: 66 LRNADLVLLATPPQIALRQLPELVRHISATGMVSDVASIKTPVAQLGRQLLGDR---FIP 122 Query: 120 AHPIAGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQEH 179 HP+ G EK G AA LY+G +V++T LPE A ++ V W+ GA + +++P+ H Sbjct: 123 GHPVVGGEKTGFAAARKNLYQGARVILTPLPEQAPAALDAVCGFWQCLGATVSQMTPEAH 182 Query: 180 DAVFASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLAN 239 D A+ SHLPH+LAFA + +A + A L A G RDF+RIAAS P++W I N Sbjct: 183 DQALAATSHLPHLLAFAYMAGLADQVPA--LRDLAGGGLRDFSRIAASDPDLWTAILSEN 240 Query: 240 RDALLTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQQW 283 R A++ + A L +R M+A D ++ + RQQ+ Sbjct: 241 RSAVVQHLKALQENLDTVRQMLAGDDTRTLKAFLKQGRACRQQF 284 Lambda K H 0.320 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 291 Length adjustment: 26 Effective length of query: 269 Effective length of database: 265 Effective search space: 71285 Effective search space used: 71285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory