Align Indole-3-glycerol phosphate synthase; Short=IGPS; EC 4.1.1.48 (characterized, see rationale)
to candidate WP_012674528.1 SULAZ_RS04635 indole-3-glycerol phosphate synthase TrpC
Query= uniprot:A0A166NT80_PSEFL (278 letters) >NCBI__GCF_000021545.1:WP_012674528.1 Length = 260 Score = 166 bits (421), Expect = 4e-46 Identities = 106/264 (40%), Positives = 152/264 (57%), Gaps = 15/264 (5%) Query: 6 VLENILARKVQEVAERSAR----VSLAELENLAKAADAPRGFAKALIDQAKTKQPAVIAE 61 +LE I+ K QE+ + + + LE K D F KAL K K +IAE Sbjct: 3 ILEKIIQTKKQELENYNDKYVKHLESLSLERKKKVLD----FKKAL----KGKDINIIAE 54 Query: 62 IKKASPSKGVIRENFVPADIAKSYEKGGATCLSVLTDIDYFQGADAYLQQARAACKLPVI 121 +KKASPSKGVIR +F P IAK YE+ GA +SVLTD YFQG+ YL KLP++ Sbjct: 55 VKKASPSKGVIRHDFDPLTIAKIYEENGAKAISVLTDKQYFQGSIEYLYNISKEVKLPLL 114 Query: 122 RKDFMIDPYQIVESRALGADCVLLIVSALDDVKMAELAAVAKSVGLDVLVEVHDGDELER 181 RKDF+ID QI+E+ A GAD LLI L ++ E K +G++ LVE+H DE + Sbjct: 115 RKDFIIDKRQILEAYAYGADSYLLIAKVLTLQEIKEFINFGKELGMEPLVEIHSYDEGVK 174 Query: 182 ALKTLDTPLVGVNNRNLHTFEVNLETTLDLLPRIPR--DRLVITESGILNRADVELMEIS 239 +L ++G+NNR+L TFEV++ + L P++ +V+ ESG+ + ++ ++ Sbjct: 175 SLYA-GAVIIGINNRSLETFEVDINLSKQLAPKMKELGAEVVVAESGLNTKQELLELKNY 233 Query: 240 DVYAFLVGEAFMRAESPGTELQRL 263 V AFL+GE+ MR G +L+ L Sbjct: 234 QVDAFLIGESLMRERDIGKKLRVL 257 Lambda K H 0.318 0.135 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 260 Length adjustment: 25 Effective length of query: 253 Effective length of database: 235 Effective search space: 59455 Effective search space used: 59455 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory