Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (uncharacterized)
to candidate WP_015898929.1 PERMA_RS00225 amidohydrolase
Query= curated2:B1MZM9 (387 letters) >NCBI__GCF_000021565.1:WP_015898929.1 Length = 401 Score = 206 bits (525), Expect = 7e-58 Identities = 129/393 (32%), Positives = 210/393 (53%), Gaps = 21/393 (5%) Query: 1 MSEMNFETLQTFRRELHQIPETALEEFKTHDYLLTKLKSWQQDYMTIKTVEALPTAILVY 60 ++E + + +RR +H PE + EE++T +++ KL+ + D + I+ TA++ Sbjct: 11 LAESIKDQIVQWRRRIHMYPEISSEEYRTSEFVAEKLEEFGVDKV-IRNFGGT-TAVVGI 68 Query: 61 FQGTNPVRTIGYRTDIDALPIQEATGLDFASQHPGKMHACGHDVHMTMALGLAQYFSQHQ 120 +G + T+ R D+DALP++E TG +++S+ G MH+CGHD H M LG A+ Q + Sbjct: 69 IKGQEDI-TVALRADMDALPMEEKTGKEYSSKIKGVMHSCGHDAHTAMLLGAAKVLVQIK 127 Query: 121 PK--DNLIIFFQPAEEAES--GGKVAYDMGLFEGKWRPD--EFYGIHDQPNLPAGTLSTL 174 K N+ + FQP EE + G + G+ + PD +G+H P LPAG T Sbjct: 128 DKLKGNVKLIFQPCEERQDCRGARTLVQKGVLKD---PDVSAIFGLHVFPELPAGVFGTK 184 Query: 175 AGTLFAGTAELKVDVIGTGGHAAYPHLAKDPIVIAAELIIQLQTVVSRSVDPIAGGVVSV 234 G A + ++ +IG G HA+ PH DP++++A++I L +VSR VDP+ V+++ Sbjct: 185 EGHFLASSDVFRIKIIGKGTHASRPHKGVDPVLVSAQVINALHHIVSRKVDPLHPAVLTI 244 Query: 235 GVINGGFANNVIPDQVHFEGTVRSMTRTGLETMLTRIRKIAEGLAIANEVTINVSLESGS 294 G I GGFA N+IP+ V EGTVR+++ + + I +G+ A S + G+ Sbjct: 245 GKIKGGFAENIIPEVVEMEGTVRTLSLDLRDMIPVWIEDTIKGVTSAYGARYEFSFKEGN 304 Query: 295 YLPVENDPILATQVINFMQK--QSDINFELAQPAMTGEDFGYLLQHIPGVMLWLGVND-- 350 PV ND + + ++ D EL P M GEDF L +PG + LG+ + Sbjct: 305 -PPVINDRLTTRFTFSMLKDLFGDDRVVELENPTMGGEDFSEYLMKVPGTFIRLGIRNEK 363 Query: 351 ---SHPLHSAQLTIDESAILPGYNALKSFLLWR 380 + PLHS +DE + G +AL ++L +R Sbjct: 364 KGITAPLHSPLFDVDEDVLPDGSSAL-AYLAYR 395 Lambda K H 0.319 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 401 Length adjustment: 31 Effective length of query: 356 Effective length of database: 370 Effective search space: 131720 Effective search space used: 131720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory