Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_015898939.1 PERMA_RS06100 branched-chain amino acid transaminase
Query= BRENDA::P54691 (305 letters) >NCBI__GCF_000021565.1:WP_015898939.1 Length = 302 Score = 221 bits (563), Expect = 2e-62 Identities = 118/298 (39%), Positives = 182/298 (61%), Gaps = 6/298 (2%) Query: 9 YFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKSAK 68 YFE K VP + AKIS+ T++ HYGTA F G+R D + LF H +RL ++ K Sbjct: 5 YFEGKIVPEDQAKISIKTNSFHYGTAIFEGIRAYYDKDTDRMWGLF-FKEHYERLFQNMK 63 Query: 69 FLHYDI--SAEKIKEVIVDFVKKNQPDKSFYIRPLVYSSGLGIAPRLHNLEKDFLVYGLE 126 L+ +I S +++ E+ + ++KN YIRP+VY S L I+P+L + +Y Sbjct: 64 VLNMEIEESIDQLVEITKELIRKNNIKDDIYIRPIVYFSDLKISPKLVGYKSRIAIYTYP 123 Query: 127 MGDYLAAD-GVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAILMNSQ 185 +GDY+ + G+ +SSW R D P R K++ +Y+ SA +KTEA+ +G DEAI++N Sbjct: 124 LGDYIDINKGIKAIVSSWTRINDNMIPPRLKVAGSYVNSAFSKTEAILAGADEAIVLNKN 183 Query: 186 GKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDKSELMI 245 G V E + N+F+VR+G+++TP DILEGITR++I+TIA DLG +R I ++EL I Sbjct: 184 GYVSEGSAENIFIVRDGKLITPPVSDDILEGITRNAIITIAKDLGYQVIERHISRTELYI 243 Query: 246 ADEVFLSGTAAKITPVKRIENFTLGGDRP--ITEKLRSVLTAVTENREPKYQDWVFKI 301 ADE+F GT A+++PV +++ +G P IT++++ V + KY+ WV I Sbjct: 244 ADEIFFCGTGAQVSPVVEVDHRKIGDGSPGKITKEIQEVYFNAVRGKIEKYRHWVIPI 301 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 302 Length adjustment: 27 Effective length of query: 278 Effective length of database: 275 Effective search space: 76450 Effective search space used: 76450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory