Align branched-chain-amino-acid aminotransferase; EC 2.6.1.42 (characterized)
to candidate WP_015898939.1 PERMA_RS06100 branched-chain amino acid transaminase
Query= CharProtDB::CH_024500 (309 letters) >NCBI__GCF_000021565.1:WP_015898939.1 Length = 302 Score = 235 bits (600), Expect = 8e-67 Identities = 123/303 (40%), Positives = 192/303 (63%), Gaps = 11/303 (3%) Query: 7 DYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCY---DSHKGPVVFRHREHMQRLHD 63 +YI+F G++V + AK+ + +++ HYGT++FEGIR Y D+ + +F +EH +RL Sbjct: 2 EYIYFEGKIVPEDQAKISIKTNSFHYGTAIFEGIRAYYDKDTDRMWGLF-FKEHYERLFQ 60 Query: 64 SAKIYRFPVSQSIDELMEACRDVIRKNNLTS-AYIRPLIFVGDVGMGVNPP-AGYSTDVI 121 + K+ + +SID+L+E +++IRKNN+ YIRP+++ D + ++P GY + + Sbjct: 61 NMKVLNMEIEESIDQLVEITKELIRKNNIKDDIYIRPIVYFSD--LKISPKLVGYKSRIA 118 Query: 122 IAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQ 181 I +P G Y+ + +GI A+VSSW R N IP K G+Y++S +EA G Sbjct: 119 IYTYPLGDYID---INKGIKAIVSSWTRINDNMIPPRLKVAGSYVNSAFSKTEAILAGAD 175 Query: 182 EGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQV 241 E I L+ NGY+SEG+ EN+F V+DG L TPP + L GITR+AII +AK+LG +V E+ Sbjct: 176 EAIVLNKNGYVSEGSAENIFIVRDGKLITPPVSDDILEGITRNAIITIAKDLGYQVIERH 235 Query: 242 LSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDKW 301 +SR LY+ADE+F GT A+++PV VD ++G+G G +TK IQ+ +F G+ E Sbjct: 236 ISRTELYIADEIFFCGTGAQVSPVVEVDHRKIGDGSPGKITKEIQEVYFNAVRGKIEKYR 295 Query: 302 GWL 304 W+ Sbjct: 296 HWV 298 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 302 Length adjustment: 27 Effective length of query: 282 Effective length of database: 275 Effective search space: 77550 Effective search space used: 77550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory