Align Cystathionine beta-synthase; Beta-thionase; Hemoprotein H-450; Serine sulfhydrase; EC 4.2.1.22 (characterized)
to candidate WP_012589541.1 MSIL_RS02540 cysteine synthase A
Query= SwissProt::P32232 (561 letters) >NCBI__GCF_000021745.1:WP_012589541.1 Length = 343 Score = 221 bits (562), Expect = 5e-62 Identities = 134/336 (39%), Positives = 189/336 (56%), Gaps = 14/336 (4%) Query: 77 ILRKIGNTPMVRINRISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGTLKPG 136 ++ IGNTP++++ R S+ +C +L K EF N GGSVKDR +L ++ DA G LKPG Sbjct: 7 VIEAIGNTPLIKLRRASEET--QCLILGKAEFQNPGGSVKDRAALAIVADAVARGALKPG 64 Query: 137 DTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDS 196 I+E T+GNTGIGLAL A GY+ +IV+PE S EK D+LR GAE++ P + Sbjct: 65 GVIVEGTAGNTGIGLALVANALGYKTVIVIPETQSQEKKDLLRLQGAELIEVPA-VPYAD 123 Query: 197 PESHV----GVAWRLKNEIPNSHI-LDQYRNASNPLAHYDDTAEEILQQCDGKVDMLVAS 251 P ++V +A RL E P I +Q+ N +N H++ T EI Q DG+VD V++ Sbjct: 124 PNNYVKLSGRLAERLAKENPAGAIWANQFDNVANRQGHFETTGPEIFAQTDGRVDGFVSA 183 Query: 252 AGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEV-EGIGYDFIPT 310 GTGGT+ G+ LK K PG +I DP G+ L + + + + EGIG I Sbjct: 184 VGTGGTLAGVGMALKAKNPGVQIALADPPGAALYSYYTTGELKSSGSSITEGIGQGRITA 243 Query: 311 VLDRAVVDRWFKSNDDDSFAFARMLISQEGLLCGGSSGSAMAVAVKAAQELKEGQRCVVI 370 L+ A +D ++ D++S L EGLL GGSSG +A A++ A+EL G V I Sbjct: 244 NLEGAPIDFAYQIGDEESVRLVFDLAENEGLLLGGSSGVNVAGAIRLARELGPGHTIVTI 303 Query: 371 LPDSVRNYMSK-----FLSDKWMLQKGFMKEELSVK 401 L DS Y SK FL K + G+++ L +K Sbjct: 304 LCDSGSRYQSKLFNPEFLRSKNLPTPGWLERPLQIK 339 Lambda K H 0.317 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 463 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 561 Length of database: 343 Length adjustment: 32 Effective length of query: 529 Effective length of database: 311 Effective search space: 164519 Effective search space used: 164519 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory