Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate WP_012589541.1 MSIL_RS02540 cysteine synthase A
Query= BRENDA::P9WP53 (323 letters) >NCBI__GCF_000021745.1:WP_012589541.1 Length = 343 Score = 144 bits (364), Expect = 2e-39 Identities = 100/319 (31%), Positives = 159/319 (49%), Gaps = 33/319 (10%) Query: 6 SLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEAD 65 S+++A+GNTPL+ L+R S + + K E +NP GS+KDR A+ ++ A A Sbjct: 6 SVIEAIGNTPLIKLRRAS-------EETQCLILGKAEFQNPGGSVKDRAALAIVADAVAR 58 Query: 66 GLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQII---- 121 G L+PG I+E T+GNTGI LA+ A GY+ + V+PE S E++ LL L GA++I Sbjct: 59 GALKPGGVIVEGTAGNTGIGLALVANALGYKTVIVIPETQSQEKKDLLRLQGAELIEVPA 118 Query: 122 --FSAAEGGSNTAVATAKELAATNPSW-VMLYQYGNPANTDSHYCGTGPELLADLP-EIT 177 ++ + A+ LA NP+ + Q+ N AN H+ TGPE+ A + Sbjct: 119 VPYADPNNYVKLSGRLAERLAKENPAGAIWANQFDNVANRQGHFETTGPEIFAQTDGRVD 178 Query: 178 HFVAGLGTTGTLMGTGRFLREHVANVKIVAAEPRYGEGVYA--------------LRNMD 223 FV+ +GT GTL G G L+ V+I A+P G +Y+ + Sbjct: 179 GFVSAVGTGGTLAGVGMALKAKNPGVQIALADPP-GAALYSYYTTGELKSSGSSITEGIG 237 Query: 224 EGFVPELYDPEILTARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAA 283 +G + + + Y +G ++VR +L EG+ G S+G + A+ + A Sbjct: 238 QGRITANLEGAPIDFAYQIGDEESVRLVFDLAENEGLLLGGSSGVNVAGAIRL---AREL 294 Query: 284 GERADIALVVADAGWKYLS 302 G I ++ D+G +Y S Sbjct: 295 GPGHTIVTILCDSGSRYQS 313 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 343 Length adjustment: 28 Effective length of query: 295 Effective length of database: 315 Effective search space: 92925 Effective search space used: 92925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory