Align O-phosphoserine sulfhydrylase monomer (EC 2.5.1.47; EC 2.5.1.65) (characterized)
to candidate WP_012589541.1 MSIL_RS02540 cysteine synthase A
Query= metacyc::MONOMER-20568 (299 letters) >NCBI__GCF_000021745.1:WP_012589541.1 Length = 343 Score = 186 bits (473), Expect = 5e-52 Identities = 119/315 (37%), Positives = 166/315 (52%), Gaps = 21/315 (6%) Query: 5 NILETIGNTPLVRINHLNPNPKVQMYAKLEGFNPTGSVKDRIALKMIEQAEAEGKLHPGS 64 +++E IGNTPL+++ + + + K E NP GSVKDR AL ++ A A G L PG Sbjct: 6 SVIEAIGNTPLIKLRRASEETQCLILGKAEFQNPGGSVKDRAALAIVADAVARGALKPGG 65 Query: 65 TIIEATSGNTGIGLAMIGRVKGYNVIIVMSEGVSIERRKMIKAFGAEII------LTDKK 118 I+E T+GNTGIGLA++ GY +IV+ E S E++ +++ GAE+I D Sbjct: 66 VIVEGTAGNTGIGLALVANALGYKTVIVIPETQSQEKKDLLRLQGAELIEVPAVPYADPN 125 Query: 119 LGTDGAIRKVAELVKENPGKYFNPNQFSNEYNKIAHYKTTAEEIWAQTKGTVTHFVAAVG 178 + R L KENP NQF N N+ H++TT EI+AQT G V FV+AVG Sbjct: 126 NYVKLSGRLAERLAKENPAGAIWANQFDNVANRQGHFETTGPEIFAQTDGRVDGFVSAVG 185 Query: 179 TSGTLMGVGKNLREKNPEIKIIEAQP---------TKGHYIQGLKSMEEAI----VPAIY 225 T GTL GVG L+ KNP ++I A P T G S+ E I + A Sbjct: 186 TGGTLAGVGMALKAKNPGVQIALADPPGAALYSYYTTGELKSSGSSITEGIGQGRITANL 245 Query: 226 QADKIDEHILIESEEAFAKAREIVAQEGIFIGMSSGAAMLAAQKLAEKIDSG-VIVVLFA 284 + ID I EE+ ++ EG+ +G SSG + A +LA ++ G IV + Sbjct: 246 EGAPIDFAYQIGDEESVRLVFDLAENEGLLLGGSSGVNVAGAIRLARELGPGHTIVTILC 305 Query: 285 DRGEKYLSTKLFDTE 299 D G +Y S KLF+ E Sbjct: 306 DSGSRYQS-KLFNPE 319 Lambda K H 0.315 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 343 Length adjustment: 28 Effective length of query: 271 Effective length of database: 315 Effective search space: 85365 Effective search space used: 85365 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory