Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_012590055.1 MSIL_RS05250 O-succinylhomoserine sulfhydrylase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000021745.1:WP_012590055.1 Length = 406 Score = 377 bits (969), Expect = e-109 Identities = 196/384 (51%), Positives = 262/384 (68%), Gaps = 1/384 (0%) Query: 21 TLAVRAGQRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGNVYSRYTNPTVRTFEE 80 TL V G RTP GE EALF T YVF + AARFAGE PG VYSRY NPTV FE Sbjct: 15 TLLVHGGGVRTPFGETSEALFLTQGYVFASMEACAARFAGEEPGFVYSRYGNPTVAMFEG 74 Query: 81 RIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGIQV 140 R+A LEGAE A ATA+GM+A+ A VMS +GDHV+ +R++FG+ + + + R+G+ Sbjct: 75 RMALLEGAEAARATATGMAAVTASVMSQVRAGDHVVAARALFGACRYIVEDHLPRYGVAS 134 Query: 141 DYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVDNCFCTP 200 DL W AA + TK+FF+ESP+NP ++ DIAA+A+IAH GA+L VDN F TP Sbjct: 135 TLVDGDDLDQWRAAVRLETKVFFLESPTNPCLDVYDIAAIAKIAHDAGAILVVDNVFATP 194 Query: 201 ALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMK-EVVGFLRTAGPTLSPFNAW 259 LQ+PL LGAD+V++SATK+IDG GR +GGV+ G ++ ++ FLR GP LSPFNAW Sbjct: 195 MLQKPLTLGADLVVYSATKHIDGGGRCLGGVILGAKALVEGDLQQFLRQTGPALSPFNAW 254 Query: 260 LFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQSGFGAV 319 + LK LETL IR++ + SA +A++L QP + V Y G HP ++ARRQ SG G + Sbjct: 255 VLLKALETLAIRVERQTKSAARIADFLSEQPAVAFVRYPGRADHPHADIARRQMSGGGTL 314 Query: 320 VSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGDSL 379 V+F++ GG+ AA+ F A +++ I++NLGD K+ I HPATT+H RL PE RA G+ + L Sbjct: 315 VAFEIVGGKPAAFAFGRALKLIKISSNLGDAKSLITHPATTTHHRLPPEARAALGVSEGL 374 Query: 380 IRVAVGLEDLDDLKADMARGLAAL 403 +R++VGLED +DL D+ L AL Sbjct: 375 VRLSVGLEDEEDLIDDLKAALDAL 398 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 406 Length adjustment: 31 Effective length of query: 372 Effective length of database: 375 Effective search space: 139500 Effective search space used: 139500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory