Align asparagine synthetase B, glutamine-hydrolyzing; EC 6.3.5.4 (characterized)
to candidate WP_015933298.1 MNOD_RS33010 asparagine synthetase B
Query= CharProtDB::CH_002444 (554 letters) >NCBI__GCF_000022085.1:WP_015933298.1 Length = 470 Score = 174 bits (441), Expect = 7e-48 Identities = 146/466 (31%), Positives = 227/466 (48%), Gaps = 46/466 (9%) Query: 1 MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDV-NAG 59 MC I G F++ V R + L HRGPD SG+ ++ A+ H RLS+VD+ +A Sbjct: 1 MCGIIGSFNLPGFDVSSRLEQLA------HRGPDGSGVLSAGPAVHGHVRLSLVDLTSAS 54 Query: 60 AQPLYNQQKTHVLAVNGEIYNHQALRAE-YGDRYQFQTGSDCEVILALYQEKGPEFLDDL 118 QP + VL NGEI+N+Q +RA+ + +F+T D EV+ A+ G L L Sbjct: 55 DQPF--RYGDAVLTFNGEIWNYQEVRAQLQAEGVRFRTAGDTEVLAAVLHRWGVHGLARL 112 Query: 119 QGMFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTIKEFPAG 178 +GMFAFA S+ + +++ RD G IPLY+ +G + +SE K L C P G Sbjct: 113 EGMFAFAW--SKGEMHILVRDRFGEIPLYVHRKGNGFAW-SSERKGLGRDC-PAAPLPPG 168 Query: 179 SYLWSQDGEIRSYYHRDWFDYDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGL 238 L +GE+R +Y R ++ + D L + D V+ L++D P L+SGGL Sbjct: 169 CVLDLPNGEVRPWYERP--EHPGIND------RLISLVRDGVERRLVADAPLCCLISGGL 220 Query: 239 DSSIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPG-SPDLKAAQEVANHLGTVHHE 297 DSS++ A+ K AR+ P + ++ L G S DL+AA+ + + E Sbjct: 221 DSSLVLALAK---ARK-----------PDVVAYTAVLDGESADLRAARRLCDEFEVPLVE 266 Query: 298 IHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGG 357 + G DA+ IE + + ++ I + G K LSGE +DE+FGG Sbjct: 267 VPVPAPTG-DALEAAARAIEIDSKAQVEIAALCIPLAHAIASDGFKACLSGEAADELFGG 325 Query: 358 Y-LYFHKAPNAKEL--HEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAM 414 Y K +A ++ E V +LL + + R NKA A GVE R+PF++++ ++ + Sbjct: 326 YGNMCIKGASASDIGWREIRVAQLLKMARGNFVRCNKAFMAAGVECRLPFIERRLVEAVI 385 Query: 415 RINPQDKMCGNGKMEKHILRECFEAYLPASVAWRQKEQFSDGVGYS 460 + + G G L++ +P V R K+ F G G S Sbjct: 386 AMTKAECPPGKG-----ALKQAAAGIVPGWVVKRPKDTFQGGAGMS 426 Lambda K H 0.319 0.135 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 581 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 554 Length of database: 470 Length adjustment: 34 Effective length of query: 520 Effective length of database: 436 Effective search space: 226720 Effective search space used: 226720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory