Align acetylornithine transaminase (EC 2.6.1.11); 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate WP_015817132.1 TERTU_RS03190 acetylornithine transaminase
Query= BRENDA::P73133 (429 letters) >NCBI__GCF_000023025.1:WP_015817132.1 Length = 386 Score = 324 bits (830), Expect = 3e-93 Identities = 165/389 (42%), Positives = 243/389 (62%), Gaps = 14/389 (3%) Query: 32 DTYVMNTYGRFPIAIARGQGSTLWDTEGKSYLDFVAGIATCTLGHAHPALVRAVSDQIQK 91 D+ +MNTYG + +G G+ LWD+EG YLD ++GIA C LG+ HPA+ RA+++Q +K Sbjct: 3 DSALMNTYGERTTTLVKGDGAYLWDSEGNRYLDALSGIAVCGLGYNHPAVTRAIAEQAEK 62 Query: 92 LHHVSNLYYIPEQGELAKWIVEHSCADRVFFCNSGAEANEAAIKLVRKYAHTVLDFLEQP 151 L H SNLY I Q L + +V+ S ++VFF NSGAEANEAA+K+ RK+ + P Sbjct: 63 LIHCSNLYLIEPQQALGQILVDTSGMEKVFFSNSGAEANEAALKIARKFGQQ--KGISHP 120 Query: 152 VILTAKASFHGRTLATITATGQPKYQQYFDPLVPGFDYVPYNDIRSLENKVADLDEGNSR 211 ++TA SFHGRT+AT++ATG K +Q F+PLV GF +VPYND+ +++ + Sbjct: 121 HVITADRSFHGRTMATLSATGNTKVKQGFEPLVEGFSHVPYNDVDAIK------AAATAN 174 Query: 212 VAAIFLEPLQGEGGVRPGDLAYFKRVREICDQNDILLVFDEVQVGVGRTGKLWGYEHLGV 271 AI +EP+QGEGGV Y +RE+CD ND LL+ DE+Q G GRTG+ + Y+H + Sbjct: 175 TVAIMVEPVQGEGGVNVPAPDYLNALRELCDSNDWLLILDEIQTGNGRTGRFFAYQHNNI 234 Query: 272 EPDIFTSAKGLAGGVPIGAMMCK-KFCDVFEPGNHASTFGGNPLACAAGLAVLKTIEGDR 330 PD+ T+AKGL GVPIGA + + K ++ +PGNH STFGGNPL C AGLA KT+ Sbjct: 235 LPDVVTTAKGLGNGVPIGACLARGKAAEILQPGNHGSTFGGNPLVCNAGLAATKTLLEQD 294 Query: 331 LLDNVQARGEQLRSGLAEIKNQYPTLFTEVRGWGLINGLEISAESSLTSVEIVKAAMEQG 390 L+ A GE + + E + + ++RG GL+ G+E+ ++V A ++G Sbjct: 295 LMTRAAALGEMMLTQFRETLSDVACV-VDIRGKGLMIGIELDQPCG----DLVAQAKQKG 349 Query: 391 LLLAPAGPKVLRFVPPLVVTEAEIAQAVE 419 +L+ +R +PPL++++ + V+ Sbjct: 350 VLINVTAGNTIRLLPPLIISDEQARTIVD 378 Lambda K H 0.320 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 386 Length adjustment: 31 Effective length of query: 398 Effective length of database: 355 Effective search space: 141290 Effective search space used: 141290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory