Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_012758419.1 RLEG_RS14800 pyridoxal phosphate-dependent aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_000023185.1:WP_012758419.1 Length = 400 Score = 223 bits (567), Expect = 1e-62 Identities = 132/396 (33%), Positives = 208/396 (52%), Gaps = 13/396 (3%) Query: 3 LAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHG 62 LA L R+ + +V +A++L+A+G+ +I LG G+PDF TP ++ AA A++ G Sbjct: 4 LADALSRVKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKTAAIDAINRGETK 63 Query: 63 YVLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPTP 122 Y +GI E R+A+ K K+ D E+ ++ GGK ++ A PG E++ P P Sbjct: 64 YTPVSGIPELRKAIAAKFKRENGLDYSWEQTIVGTGGKQILFNAFMATLNPGDEVVIPAP 123 Query: 123 AFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEK 182 + Y M+ G TPV T++ + K + IT KT+ I +P+NPTG+ + Sbjct: 124 YWVSYPEMVALCGGTPVFVSATQEHNFKLQAADLEKAITPKTKWFIFNSPSNPTGAAYTQ 183 Query: 183 SAIDVLAEGLKKHPHVAILSDEIYSRQIY-DGKEMPTFFNYPDLQDRLIVLDGWSKAYAM 241 + + L + L KHP V +L+D++Y Y D K + P L DR + ++G SKAYAM Sbjct: 184 AELKALTDVLMKHPQVWVLTDDMYEHLTYGDFKFVTPVEVEPKLYDRTLTMNGVSKAYAM 243 Query: 242 TGWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRK 301 TGWR+G++ P +LI ++ + S + +Q+A + AL+G D I F+ RR Sbjct: 244 TGWRIGYAAGPIQLIKAMDMIQGQQTSGATSIAQWAAVEALNGTQDFIPANKKIFEGRRD 303 Query: 302 LIHEGLNSLPGVECSLPGGAFYAFPKVIG----TGMNG------SEFAKKCMHEAGVAIV 351 L+ LN G+ C +P GAFY +P G T +G +F + + GVA+V Sbjct: 304 LVVSMLNQAKGIVCPVPEGAFYVYPSCAGLIGKTAPSGKVIETDEDFVSELLETEGVAVV 363 Query: 352 PGTAFGKTCQDYVRFSYAASQDNISNALENIKKMLG 387 G+AFG R SYA S++ + A I++ G Sbjct: 364 HGSAFG--LGPNFRISYATSEEQLEEACRRIQRFCG 397 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 400 Length adjustment: 31 Effective length of query: 356 Effective length of database: 369 Effective search space: 131364 Effective search space used: 131364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory