Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized)
to candidate WP_012755978.1 RLEG_RS01285 pyridoxal phosphate-dependent aminotransferase
Query= curated2:B1I544 (392 letters) >NCBI__GCF_000023185.1:WP_012755978.1 Length = 388 Score = 152 bits (383), Expect = 2e-41 Identities = 109/352 (30%), Positives = 165/352 (46%), Gaps = 4/352 (1%) Query: 34 VISLGIGDPDVPTPDHIIEAAEKELKIPANHQYPSSAGMPAYRRAVADWYARRFGVELDP 93 ++ L +G+ D+PTPD I AA L Y G+P R+A++D+Y R FG+ L Sbjct: 32 LLPLWVGEGDLPTPDFISRAAMDALASGETF-YTWQRGIPELRQALSDYYDRHFGIRLPV 90 Query: 94 QREVVSLIGSKEGIAHLPWCFVDPGDVVLVPDPGYPVYAGGTILAGGIPHPVPLT-AGNG 152 + V+ G + I PGD ++ P +P A +AG V L G Sbjct: 91 EHFYVTGSGM-QAIQIAVQALTSPGDELVYLSPSWPNIAAALEIAGARSLSVELQFEGGK 149 Query: 153 FLPDLAAIPAETARRAKVMFINYPNNPTGAVASKEFFARVVDFAREYGILVCHDAAYSEI 212 + DL I + K +FIN P+NPTG A+K+ ++ AR++ + + D Y+ Sbjct: 150 WAVDLDRIETAITPKTKGIFINTPSNPTGWTATKQDLGDLLALARKHDLWIMADEIYARY 209 Query: 213 AFDGYRPPSFLEVAGAREVGIEFHSVSKTYNMTGWRAGWAAGNAGAVEALGRLKSNLDSG 272 F G R PSFL+V + I +S SK ++MTGWR GW + L L SG Sbjct: 210 YFAGGRAPSFLDVMEPDDKIIFVNSFSKNWSMTGWRVGWIVAPPEMGQVLENLIQYSTSG 269 Query: 273 VFQVVQYAAIAALNGPQDGVQSLCEMYRERRDLVVDTLNDLGWRLT-RPRATFYIWAPVP 331 V Q +Q A+AAL+ D V + RD + D L T +P Y + + Sbjct: 270 VAQFMQKGAVAALDQGDDFVAANIAKAARSRDTLCDALVATNRVETLKPDGAIYAFLKID 329 Query: 332 AGHDASSFAEMVLEKAGVVITPGTGYGTYGEGYFRISLTLPTPRLVEAMERL 383 D+ + A +++K GV + PGT +G+ GE + R ++ A ERL Sbjct: 330 GVADSRTAALDIVDKTGVGLAPGTAFGSGGELFLRACFLRDPTQVAIAAERL 381 Lambda K H 0.321 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 388 Length adjustment: 31 Effective length of query: 361 Effective length of database: 357 Effective search space: 128877 Effective search space used: 128877 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory