Align aspartate transaminase (EC 2.6.1.1); aspartate-prephenate aminotransferase (EC 2.6.1.78); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_012760642.1 RLEG_RS34460 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q02635 (400 letters) >NCBI__GCF_000023185.1:WP_012760642.1 Length = 400 Score = 454 bits (1167), Expect = e-132 Identities = 217/400 (54%), Positives = 283/400 (70%) Query: 1 MAFLADALSRVKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKKAAIDAIDRG 60 M+ +AD L V SA+ A++Q+AREL AKG V+ L +GEPDF TP + +AA A G Sbjct: 1 MSVIADRLKNVSISASAAMTQRARELAAKGIKVVSLSSGEPDFPTPAHAIEAAYGAALAG 60 Query: 61 ETKYTPVSGIPELREAIAKKFKRENNLDYTAAQTIVGTGGKQILFNAFMATLNPGDEVVI 120 +TKY P+ G P L+ AI +KFKR+NNLDY A+Q +V GGKQ++FNA +AT NPGDEVVI Sbjct: 61 DTKYPPMDGTPVLKSAIIRKFKRDNNLDYDASQIVVSGGGKQVIFNAMLATCNPGDEVVI 120 Query: 121 PAPYWVSYPEMVALCGGTPVFVPTRQENNFKLKAEDLDRAITPKTKWFVFNSPSNPSGAA 180 P P WVSY ++V GG PV VP ++ FKL EDL+ AITP+TKW N P+NP+GAA Sbjct: 121 PTPSWVSYADIVKFAGGVPVAVPCHEQTGFKLHPEDLEAAITPRTKWLFLNFPNNPTGAA 180 Query: 181 YSHEELKALTDVLMKHPHVWVLTDDMYEHLTYGDFRFATPVEVEPGLYERTLTMNGVSKA 240 S E+ A+ +V+++HP+VW++TDD+YEHL Y DF+F T EVEP LY+R LTMNGVSKA Sbjct: 181 CSRAEMAAIAEVMLRHPNVWIMTDDIYEHLVYDDFQFCTIAEVEPRLYDRVLTMNGVSKA 240 Query: 241 YAMTGWRIGYAAGPLHLIKAMDMIQGQQTSGAASIAQWAAVEALNGPQDFIGRNKEIFQG 300 YAMTGWR+G+ AGP LI A+ + GQ G A++ Q AA AL+GPQD + I++ Sbjct: 241 YAMTGWRLGFCAGPKELISAVSNVNGQNGGGIATLTQAAATAALDGPQDLLKERAAIYKE 300 Query: 301 RRDLVVSMLNQAKGISCPTPEGAFYVYPSCAGLIGKTAPSGKVIETDEDFVSELLETEGV 360 RRD V+ L++ +G+ C PEGAFY+YP+ +GLIGKT+ G+ IETD DFV L++ V Sbjct: 301 RRDFVLDRLSEVEGLRCHRPEGAFYIYPNISGLIGKTSKGGRKIETDVDFVMALVDEHHV 360 Query: 361 AVVHGSAFGLGPNFRISYATSEALLEEACRRIQRFCAACR 400 A V G+A+G+ P FRISYATS L E C RI +FC R Sbjct: 361 ATVQGAAYGMSPFFRISYATSMEKLGEGCARIAQFCRDMR 400 Lambda K H 0.318 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 498 Number of extensions: 21 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 400 Length adjustment: 31 Effective length of query: 369 Effective length of database: 369 Effective search space: 136161 Effective search space used: 136161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory