Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized)
to candidate WP_015798933.1 AFER_RS07925 pyridoxal phosphate-dependent aminotransferase
Query= curated2:B1I544 (392 letters) >NCBI__GCF_000023265.1:WP_015798933.1 Length = 398 Score = 193 bits (490), Expect = 8e-54 Identities = 131/395 (33%), Positives = 183/395 (46%), Gaps = 13/395 (3%) Query: 6 AKRIRNLPPYLFARIEQLIADKKAQGVDVISLGIGDPDVPTPDHIIEAAEKELKIPANHQ 65 A R+ L P I+Q A G+DV+S G+PD PTPD I+EAA + P NH+ Sbjct: 7 ATRLTELSPSATLAIDQRAKAMVASGIDVVSFAAGEPDFPTPDFIVEAATAAARDPRNHR 66 Query: 66 YPSSAGMPAYRRAVADWYARRFGVELDPQREVVSLIGSKEGIAHLPWCFVDPGDVVLVPD 125 Y +AG+ R + + R G + P VV+ G K I V+PGD VL+P Sbjct: 67 YTPAAGLGELRELIVEVTKRDSGRVVSPSNVVVTN-GGKHAIYEAMAAIVEPGDEVLIPA 125 Query: 126 PGYPVYAGGTILAGGIPHPVPLTAGNGFLPDLAAIPAETARRAKVMFINYPNNPTGAVAS 185 P + Y L GG+P VP T NGF + A R P+NPTGAV S Sbjct: 126 PYWVSYPEIVRLFGGVPVAVPTTLANGFKVTPEQVEAAITDRTVAFIHVSPSNPTGAVYS 185 Query: 186 KEFFARVVDFAREYGILVCHDAAYSEIAFDGYRPPSFLEV-AGAREVG-IEFHSVSKTYN 243 ++ + + GI V D Y + + G R S EV A E I+ + V+KT+ Sbjct: 186 RDESRALAEVLERAGIWVLTDEIYQHLTYTGQRATSLAEVGTEALEARLIQVNGVAKTFA 245 Query: 244 MTGWRAGWAAGNAGAVEALGRLKSNLDSGVFQVVQYAAIAALNGPQDGVQSLCEMYRERR 303 MTGWR GW A A+ L+S L S V V Q AAIAAL P + + + + RR Sbjct: 246 MTGWRVGWIVAPAPVASAVANLQSQLSSNVANVSQRAAIAALEAPLEATAPMRDAFARRR 305 Query: 304 DLVVDTLNDL-GWRLTRPRATFYIWAPVP-------AGHDASSFAEMVLEKAGVVITPGT 355 +V L + G + P FY++ + A A +LE+A V + PG Sbjct: 306 TTIVSALAGIEGLDVLWPDGAFYVFPSLARVLEVQMPSSSALELATRLLEEAHVAVVPGE 365 Query: 356 GYGTYGEGYFRISLTLPTPRLVEAMERLRGCLGRV 390 + G G +R+S L L E + R+ +GR+ Sbjct: 366 AFD--GPGAWRLSYALGDDALEEGVRRIAEFIGRL 398 Lambda K H 0.321 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 398 Length adjustment: 31 Effective length of query: 361 Effective length of database: 367 Effective search space: 132487 Effective search space used: 132487 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory