Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_015798933.1 AFER_RS07925 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_000023265.1:WP_015798933.1 Length = 398 Score = 219 bits (558), Expect = 1e-61 Identities = 135/371 (36%), Positives = 209/371 (56%), Gaps = 17/371 (4%) Query: 23 LVAQHEDVISLTIGQPDFFTPHH-VKAAAKKAIDENVTSYTPNAGYLELRQAVQLYMKKK 81 +VA DV+S G+PDF TP V+AA A D YTP AG ELR+ + + + K+ Sbjct: 28 MVASGIDVVSFAAGEPDFPTPDFIVEAATAAARDPRNHRYTPAAGLGELRELI-VEVTKR 86 Query: 82 ADFNYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLCGAKPVIVD 141 + S +++T G AI A I+ PGDEV++P P + Y I+ L G PV V Sbjct: 87 DSGRVVSPSNVVVTNGGKHAIYEAMAAIVEPGDEVLIPAPYWVSYPEIVRLFGGVPVAVP 146 Query: 142 TT-SHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIAALLKGRNVFVLSD 200 TT ++GFK+T +E A+T T + PSNPTG S +E +++A +L+ ++VL+D Sbjct: 147 TTLANGFKVTPEQVEAAITDRTVAFIHVSPSNPTGAVYSRDESRALAEVLERAGIWVLTD 206 Query: 201 EIYSELTY-DRPHYSIATY----LRDQTIVINGLSKSHSMTGWRIGFLFAPKDIAKHILK 255 EIY LTY + S+A L + I +NG++K+ +MTGWR+G++ AP +A + Sbjct: 207 EIYQHLTYTGQRATSLAEVGTEALEARLIQVNGVAKTFAMTGWRVGWIVAPAPVASAVAN 266 Query: 256 VHQYNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLDYVYDRLVSM-GLDVVKPSGA 314 + S +++SQ+AA+ A+ + MR+ + +R + L + GLDV+ P GA Sbjct: 267 LQSQLSSNVANVSQRAAIAALEAPLEATAPMRDAFARRRTTIVSALAGIEGLDVLWPDGA 326 Query: 315 FYIFPS------IKSFGMTSFDFSMALLEDAGVALVPGSSFSTYGEGYVRLSFACSMDTL 368 FY+FPS ++ ++ + + LLE+A VA+VPG +F G G RLS+A D L Sbjct: 327 FYVFPSLARVLEVQMPSSSALELATRLLEEAHVAVVPGEAFD--GPGAWRLSYALGDDAL 384 Query: 369 REGLDRLELFV 379 EG+ R+ F+ Sbjct: 385 EEGVRRIAEFI 395 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 15 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 398 Length adjustment: 31 Effective length of query: 362 Effective length of database: 367 Effective search space: 132854 Effective search space used: 132854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory