Align Cystathionine gamma-synthase/O-acetylhomoserine (thiol)-lyase; CGS/OAH thiolyase; O-acetylhomoserine sulfhydrylase; OAH sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_049755415.1 AFER_RS07735 PLP-dependent aspartate aminotransferase family protein
Query= SwissProt::O31631 (373 letters) >NCBI__GCF_000023265.1:WP_049755415.1 Length = 368 Score = 166 bits (421), Expect = 7e-46 Identities = 122/333 (36%), Positives = 173/333 (51%), Gaps = 33/333 (9%) Query: 46 YVRTKNPTRQLVEDAIANLENGARGLAFSSGMAAIQTIMALFKSGDELIVSSDLYGGTYR 105 Y R NPT + E I LE G +AF SG AA T L G +V +D Y GT + Sbjct: 48 YGRHTNPTWEAFEALIGELEGGT-AVAFGSGAAA--TFALLLALGPRALVVADSYMGTRQ 104 Query: 106 LFENEWKKYGLT-FHYDDFSDEDCLRSKITPNTKAVFVETPTNPLMQEADIEHIARITKE 164 L W + + SD D ++ P + V +ETP+NPL+ I +A+ E Sbjct: 105 LAR--WLGARIPGIELVEPSDLDAHLDRLAPGS-VVLIETPSNPLLVTYPIATLAKRIHE 161 Query: 165 HGLLLIVDNTFYTPVLQRPLELGADIVIHSATKYLGGHNDLLAGLVVVKDERLGEEMFQH 224 G LL VD+T TPVLQRPL LGAD+V+HSA+K+L GH+D+L G++V DE L + + Sbjct: 162 RGGLLAVDSTLATPVLQRPLTLGADVVVHSASKFLSGHSDVLGGVLVASDEDLVARVGEV 221 Query: 225 QNAIGAVLPPFDSWLLMRGMKTLSLRMRQHQANAQELAAFLEEQEEISD-VLYPG----- 278 + GA++ P +++L RG++TL++R+ + A A LA L ++ + D V YPG Sbjct: 222 RELTGAIIGPVEAYLCFRGLRTLAVRVERASATATTLAMRL--RDRLGDTVRYPGFDSEL 279 Query: 279 ---------KGGMLSFRLQKEEWVNPFLKALKTICFAESLGGVESFITYPATQTHMDIPE 329 G +++ L+ + + L L A SLGGVES + P Sbjct: 280 VGPGRQQSAGGALVALELESAQQADAMLDGLSLFHHATSLGGVESL-----AERRGRYPG 334 Query: 330 EIRIANGVCNRLLRFSVGIEHAEDLKEDLKQAL 362 E RI G L+R SVG+E EDL DL +AL Sbjct: 335 EDRIGEG----LVRLSVGLEDVEDLWGDLDRAL 363 Lambda K H 0.319 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 368 Length adjustment: 30 Effective length of query: 343 Effective length of database: 338 Effective search space: 115934 Effective search space used: 115934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory