Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_012852504.1 TCUR_RS10655 acetylornithine transaminase
Query= BRENDA::O30508 (406 letters) >NCBI__GCF_000024385.1:WP_012852504.1 Length = 401 Score = 282 bits (722), Expect = 1e-80 Identities = 161/376 (42%), Positives = 220/376 (58%), Gaps = 12/376 (3%) Query: 18 VPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRIWHV 77 +PNY V G+G V D G+E +DF GIAV+SLGH HPAL++A+T Q I H Sbjct: 15 MPNYGLPPVALVSGQGCLVRDADGKEYLDFIAGIAVSSLGHGHPALIEAVTAQVGAIAHT 74 Query: 78 SNVFTNEPALRLA---RKLVDATFAE-RVFLANSGAEANEAAFKLARRYANDVYGPQKYE 133 SN+F NEP ++LA R+L+ A+ RVFL+NSG EANE A KLA +YA ++ Sbjct: 75 SNLFVNEPEVQLAERLRRLLGEHGAKARVFLSNSGTEANECALKLAIKYAK---AHERTY 131 Query: 134 IIAASNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVVLE 193 +AA N FHGRT+ +++ G+ + FGP + VPY D +AL+ A++ + AV LE Sbjct: 132 FVAAENGFHGRTMGALSLTGKHAIREPFGPYAIDVRFVPYGDADALRQAVTPQCAAVFLE 191 Query: 194 PIQGEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDILSS 253 P GEGGV+P YL AR +CD+ ALLV DE+QS +GR G FA+ H GV PDIL+ Sbjct: 192 PTLGEGGVVPPPDGYLSAARDICDQSGALLVIDEIQSAIGRTGTWFAHQHEGVRPDILTL 251 Query: 254 AKSLGGGFPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKA 313 AK LGGG PIGA + G + + G HG+T+GGNP+++A A A L I +LD V Sbjct: 252 AKGLGGGLPIGACIGFGPYGELFAKGDHGSTFGGNPVSAAAALAVLRTIEAEGLLDHVTK 311 Query: 314 KHERFKSRLQKIGQEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQASP 373 K L I + + +RG GL +G LT+ A V AA +V P Sbjct: 312 VGALLKEGLSAIA--HPLLKSVRGRGLWLGLVLTEP---LAAQVEAAARDAGFLVNAVQP 366 Query: 374 DVVRFAPSLVIDDAEI 389 +V+R AP L++ ++ Sbjct: 367 NVIRLAPPLIVTAEQV 382 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 401 Length adjustment: 31 Effective length of query: 375 Effective length of database: 370 Effective search space: 138750 Effective search space used: 138750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory