GapMind for Amino acid biosynthesis

 

Alignments for a candidate for gatC in Thermomonospora curvata DSM 43183

Align glutamyl-tRNAGln amidotransferase subunit C (EC 6.3.5.7) (characterized)
to candidate WP_012853879.1 TCUR_RS17545 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC

Query= metacyc::MONOMER-13957
         (96 letters)



>NCBI__GCF_000024385.1:WP_012853879.1
          Length = 99

 Score = 71.6 bits (174), Expect = 2e-18
 Identities = 38/95 (40%), Positives = 54/95 (56%)

Query: 1  MSRISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMK 60
          MS I+ +EV H+A L+RLA+ E+E      QLD IIS    + +V  +++ PT+H L + 
Sbjct: 1  MSAITRDEVAHLARLSRLALDEDELDHLAAQLDVIISAVARVQQVAAEDIPPTSHALPIT 60

Query: 61 NVMREDEAGKGLPVEDVMKNAPDHKDGYIRVPSIL 95
          NV R DE    L  E  +  AP  ++   RVP IL
Sbjct: 61 NVFRPDEVRPSLTPEQALSGAPAAEEQRFRVPRIL 95


Lambda     K      H
   0.312    0.130    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 52
Number of extensions: 3
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 96
Length of database: 99
Length adjustment: 10
Effective length of query: 86
Effective length of database: 89
Effective search space:     7654
Effective search space used:     7654
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.5 bits)
S2: 39 (19.6 bits)

Align candidate WP_012853879.1 TCUR_RS17545 (Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00135.hmm
# target sequence database:        /tmp/gapView.3483846.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00135  [M=93]
Accession:   TIGR00135
Description: gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                             -----------
    4.3e-25   74.1   0.0    4.9e-25   74.0   0.0    1.0  1  NCBI__GCF_000024385.1:WP_012853879.1  


Domain annotation for each sequence (and alignments):
>> NCBI__GCF_000024385.1:WP_012853879.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.0   0.0   4.9e-25   4.9e-25       1      92 [.       4      95 ..       4      96 .. 0.98

  Alignments for each domain:
  == domain 1  score: 74.0 bits;  conditional E-value: 4.9e-25
                             TIGR00135  1 iskeevkrlakLarlelseeeaekfaeeLkeilklveqlsevdtenvepmanplelsnklReDeveeslkrkeil 75
                                          i+++ev++la+L+rl+l+e+e +++a +L+ i++ v  +++v  e++ p+ + l+++n++R Dev+ sl+ +++l
  NCBI__GCF_000024385.1:WP_012853879.1  4 ITRDEVAHLARLSRLALDEDELDHLAAQLDVIISAVARVQQVAAEDIPPTSHALPITNVFRPDEVRPSLTPEQAL 78
                                          789************************************************************************ PP

                             TIGR00135 76 knapekedgfikvPkil 92
                                          + ap +e+  ++vP+il
  NCBI__GCF_000024385.1:WP_012853879.1 79 SGAPAAEEQRFRVPRIL 95
                                          ****************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (93 nodes)
Target sequences:                          1  (99 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 6.93
//
[ok]

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory