Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_012851938.1 TCUR_RS07800 aspartate aminotransferase family protein
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_000024385.1:WP_012851938.1 Length = 458 Score = 174 bits (441), Expect = 5e-48 Identities = 130/418 (31%), Positives = 190/418 (45%), Gaps = 52/418 (12%) Query: 30 LIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQ-TLPTPM 88 +IVRG G V+D +G Y+D + G +GHG E+ +A +QA L P + P Sbjct: 35 VIVRGDGPYVYDDKGKRYLDGLAGLFTTQVGHGRQELAQAAAKQAAELAFFPLWSYAHPK 94 Query: 89 RGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAH---TGRK---KFVAAMRGFSG 142 E L A+ P ELNRVF G EA E+A K A+ + TG+ K ++ + G Sbjct: 95 AIELAERLAALAPGELNRVFFTTGGGEAVESAWKLAKQYFKLTGKPTKHKVISRAIAYHG 154 Query: 143 RTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDV----------------------EALKR 180 T G+LS+T P + PF PLV +P ++ EA+ Sbjct: 155 TTQGALSLTGLPAIKAPFEPLVPSAFRVPNTNIYRAPVHGDDPEAFGRWAADRIEEAILF 214 Query: 181 AVDEETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAF 240 + AAV LEPVQ GG P P + + REI LL+ DE+ GR G F Sbjct: 215 EGPDTVAAVFLEPVQNAGGCFPPPPGYFQRVREICDRYDVLLVSDEVICAYGRLGTMFGA 274 Query: 241 EHFGIVPDILTLAKALGGG-VPLGVAVMREEVARSMPKG----GHGTTFGGNPLAMAAGV 295 + + PDI+T AK + G PLG ++ + + KG HG TFGG+P++ A + Sbjct: 275 QRYDYQPDIITFAKGITSGYAPLGGMLVTDRLFEPFRKGTTTFAHGYTFGGHPVSAAVAL 334 Query: 296 AAIRYLERTRLWERAAELGPWFMEKL-RAIPSPKIREVRGMGLMVGLEL-KEKAAPYIAR 353 A + ER L F L + + P + +VRG G G+EL K+KA Sbjct: 335 ANLDLFEREDLLGHVQRNEALFRSTLEKLLDLPIVGDVRGAGYFYGIELVKDKATKESFT 394 Query: 354 LEKEHRVL----------------ALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA 395 E+ R+L A G V++ PPL+ ++ E + + +RAVL+ Sbjct: 395 DEESERLLRGFVDKALFEAGLYCRADDRGDPVVQLAPPLICDRSHFEEMEQILRAVLS 452 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 458 Length adjustment: 32 Effective length of query: 363 Effective length of database: 426 Effective search space: 154638 Effective search space used: 154638 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory