Align Ornithine aminotransferase; Orn-AT; Ornithine delta-aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_012851938.1 TCUR_RS07800 aspartate aminotransferase family protein
Query= SwissProt::O50131 (454 letters) >NCBI__GCF_000024385.1:WP_012851938.1 Length = 458 Score = 193 bits (491), Expect = 9e-54 Identities = 140/432 (32%), Positives = 214/432 (49%), Gaps = 31/432 (7%) Query: 39 VIERAEGVYWIDVDGNVLLDFSSGIGVMNVGLRNPKVIEAIKKQLDLVLHAAGTDYYNPY 98 VI R +G Y D G LD +G+ VG ++ +A KQ + Y +P Sbjct: 35 VIVRGDGPYVYDDKGKRYLDGLAGLFTTQVGHGRQELAQAAAKQAAELAFFPLWSYAHPK 94 Query: 99 QVELAKKLVEIAPGDIERKVFLSNSGTEANEAALKIAKW-------STNRKMFIAFIGAF 151 +ELA++L +APG++ R VF + G EA E+A K+AK T K+ I A+ Sbjct: 95 AIELAERLAALAPGELNR-VFFTTGGGEAVESAWKLAKQYFKLTGKPTKHKVISRAI-AY 152 Query: 152 HGRTHGTMSLTASKPVQRSRMFPTMPGVVHVPYPNPYRNPWGIDGYENPDELINRVIDYI 211 HG T G +SLT P ++ P +P VP N YR P + G ++P+ D I Sbjct: 153 HGTTQGALSLTGL-PAIKAPFEPLVPSAFRVPNTNIYRAP--VHG-DDPEAFGRWAADRI 208 Query: 212 EEYLFEHYVPAEEVAGIFFEPIQGEGGYVVPPKNFFKELKKLADKHGILLIDDEVQMGMG 271 EE + + + VA +F EP+Q GG PP +F+ ++++ D++ +LL+ DEV G Sbjct: 209 EEAIL--FEGPDTVAAVFLEPVQNAGGCFPPPPGYFQRVREICDRYDVLLVSDEVICAYG 266 Query: 272 RTGRMWAIEHFDIVPDIVTVAKALG------GGIPIGATIFRADLDFGVSGVHSNTFGGN 325 R G M+ + +D PDI+T AK + GG+ + +F + H TFGG+ Sbjct: 267 RLGTMFGAQRYDYQPDIITFAKGITSGYAPLGGMLVTDRLFEPFRKGTTTFAHGYTFGGH 326 Query: 326 TVAAAAALAVIEELQ-NGLIENAQKLEPLFRERLEEMKEKYEIIGDVRGLGLAWGVEFVK 384 V+AA ALA ++ + L+ + Q+ E LFR LE++ + I+GDVRG G +G+E VK Sbjct: 327 PVSAAVALANLDLFEREDLLGHVQRNEALFRSTLEKLLD-LPIVGDVRGAGYFYGIELVK 385 Query: 385 DRKTKEYATKERGEIVVEA-LKRGLALLGC-------GKSAIRLIPPLIISEEEAKMGLD 436 D+ TKE T E E ++ + + L G G ++L PPLI + Sbjct: 386 DKATKESFTDEESERLLRGFVDKALFEAGLYCRADDRGDPVVQLAPPLICDRSHFEEMEQ 445 Query: 437 IFEEAIKVVSER 448 I + S R Sbjct: 446 ILRAVLSEASNR 457 Lambda K H 0.319 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 555 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 458 Length adjustment: 33 Effective length of query: 421 Effective length of database: 425 Effective search space: 178925 Effective search space used: 178925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory