Align prephenate dehydratase (EC 4.2.1.51) (characterized)
to candidate WP_015739147.1 ADEG_RS05820 prephenate dehydratase
Query= BRENDA::Q8DUV6 (274 letters) >NCBI__GCF_000024605.1:WP_015739147.1 Length = 276 Score = 191 bits (486), Expect = 1e-53 Identities = 113/271 (41%), Positives = 158/271 (58%), Gaps = 7/271 (2%) Query: 2 KIAYLGPSGSFTHNVALHAFPAADLLP--FENITEVIKAYESKQVCFAIVPVENSIEGSV 59 ++ +LGP+G+FT L F +++P + ++ V++A +++ +VP ENS+EGSV Sbjct: 4 RVGFLGPAGTFTEQAMLAFFAGEEIIPLAYPDLPAVLEALAQEEIAAGVVPWENSLEGSV 63 Query: 60 HETFDYLFHQAKIEAVAEIILPIKQQLMSTSADKTIETIFSHPQAIAQGKQYIRSHYPDV 119 D L A I V E++LPI L++ + I SHP A+AQ ++++R H+PDV Sbjct: 64 TLFLDLLVKTAGIYVVGEVVLPIVHHLLARPGVSSFTRILSHPHALAQCREFLRIHFPDV 123 Query: 120 KIEMTASTAYAARFVAEHPEENYAAIAPYAAADEYHLSIIAKDIQEIDENYTRFWVLGDE 179 + T STA AAR VAE E +AA+ P AA + L ++ K IQ+ EN TRF VLG E Sbjct: 124 PLFPTGSTAEAARLVAE-SSEPWAAVGPETAAKNWGLVVVKKAIQDSKENETRFAVLGKE 182 Query: 180 TPTIHLKEEDQKISLALTLPDNLPGALYKALSTFAWRGIDLTKIESRPLKTILGEYFFII 239 + K S+A L ++ PG LYKAL FA R I+LTKIESRP K LG+Y F + Sbjct: 183 RAP---RTGRDKTSVAFALTEDRPGVLYKALEEFARREINLTKIESRPAKRQLGQYIFFL 239 Query: 240 DFENHNE-KLVSFALEELTSIGIHYKILGKY 269 D E H E V ALE L + +KILG Y Sbjct: 240 DCEGHMEDPEVRAALEALKAQSSFFKILGSY 270 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 276 Length adjustment: 25 Effective length of query: 249 Effective length of database: 251 Effective search space: 62499 Effective search space used: 62499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory