Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate WP_008805274.1 KVAR_RS20550 4-aminobutyrate--2-oxoglutarate transaminase
Query= SwissProt::Q88FI7 (416 letters) >NCBI__GCF_000025465.1:WP_008805274.1 Length = 427 Score = 362 bits (930), Expect = e-105 Identities = 192/417 (46%), Positives = 260/417 (62%), Gaps = 12/417 (2%) Query: 4 ESISQSIAIVHPITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATR 63 +++ + + +HPI N VWD +G+ Y+DF GGI VLN GH +P VV A++ Q + Sbjct: 13 DAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHPQVVAAVEDQLKK 72 Query: 64 LTHYAFNAAPHGPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGATGKRAII 123 L+H F + PYLAL E+++Q VP + +L +G+EA ENA+K+AR ATG+ I Sbjct: 73 LSHTCFQVLAYEPYLALCEKMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATGRSGAI 132 Query: 124 AFDGGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFS 183 AF G +HGRT TL+L GKV PY +G +PG VY YP A GV+ ++A+ ++ R+F Sbjct: 133 AFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSDDEAIASIHRIFK 192 Query: 184 VELAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRF 243 + A ED+AA I EPVQGEGGF A PAF Q LR CDE GI++I DE+QSG GRTG F Sbjct: 193 NDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLF 252 Query: 244 AFPRLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASL 303 A ++G+ D+ AKSIAGG PL V GR E+M A+ GGLGGTY+GNPI+CAAALA L Sbjct: 253 AMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAGNPIACAAALAVL 312 Query: 304 AQMTDENLA----TWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIE-FANADGS 358 ENL G+ Q +++ E P IG + G+GAM IE F D S Sbjct: 313 QIFEQENLLEKANQLGDTLRQGLLAIAED------HPEIGDVRGLGAMIAIELFEEGDRS 366 Query: 359 PAPAQL-AKVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLAE 414 A+L A ++ AR +GL+L+ G +++R+L PLTIE +E+GL I+ C E Sbjct: 367 KPNARLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIEQGLKIIADCFTE 423 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 511 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 427 Length adjustment: 32 Effective length of query: 384 Effective length of database: 395 Effective search space: 151680 Effective search space used: 151680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory