Align Acetylornithine deacetylase; AO; Acetylornithinase; N-acetylornithinase; NAO; EC 3.5.1.16 (characterized)
to candidate WP_012968216.1 KVAR_RS12925 M20 family metallopeptidase
Query= SwissProt::P23908 (383 letters) >NCBI__GCF_000025465.1:WP_012968216.1 Length = 380 Score = 135 bits (340), Expect = 2e-36 Identities = 109/360 (30%), Positives = 155/360 (43%), Gaps = 29/360 (8%) Query: 31 SNADLITLLADWFKDLGFNVEVQPVPGTRNKFNMLASIGQGAGGLLLA--GHTDTVPFDD 88 S AD + ADW + GF V + + N++AS+ G LA GH DTVP + Sbjct: 22 SEADCMRFFADWLDESGFEVSLSSFG--EGRCNLIASLPGAKSGKPLAFTGHLDTVPLGN 79 Query: 89 GRWTRDPFTLTEHDGKLYGLGTADMK-GFFAFILDALRDVDVTKLKKPLYILATADEETS 147 RW DPF DG+LYG G++DMK AF + + + + +L T EET Sbjct: 80 ARWQYDPFGSQMEDGRLYGRGSSDMKAAIAAFAVACVHQREAILAGRGAVLLITGGEETG 139 Query: 148 MAGAR-YFAETTALRPDCAIIGEPTSLQPVRAHKGHISNAIRIQGQSGHSSDPARGVNAI 206 GAR A T I+GEPT+ PV HKG + +G++ H + P G+NAI Sbjct: 140 CDGARALIASATLPEVGALIVGEPTANYPVIGHKGALWLRCETRGKTAHGAMPELGINAI 199 Query: 207 ELMHDAIGHILQLRDNLKERYHYEAFTVPYPTLNLGHIHGGDASNRICACCELHMDIRPL 266 L DA+G I + PTLN+G I GG N + +DIR Sbjct: 200 YLAADALGKIQHFSPGAPHP------LMKQPTLNVGRIEGGLNINSVPDRTRFDVDIRSA 253 Query: 267 PGMTLNELNGLLNDALAPVSERWPGRLTVDELHPPIPGYECPPNHQLV-EVVEKLLGAKT 325 P + + L L +TV L +P +H + +V ++ Sbjct: 254 PNLQHATIRERLTTLLGE-------SVTVSTL-VDLPAVLSREDHAWIKQVYQRCQPLHA 305 Query: 326 E-----VVNYCTEAPFIQTLC---PTLVLGPGSINQAHQPDEYLETRFIKPTRELITQVI 377 E VV Y T+A + P ++LGPG + AHQ DEY + +L +I Sbjct: 306 EPIAPRVVPYFTDASLLLPALGDPPCIILGPGEPSMAHQTDEYCLLSRLAEAEQLYGDII 365 Lambda K H 0.320 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 380 Length adjustment: 30 Effective length of query: 353 Effective length of database: 350 Effective search space: 123550 Effective search space used: 123550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory