Align 2-isopropylmalate synthase 2; EC 2.3.3.13; Alpha-IPM synthase 2; Alpha-isopropylmalate synthase 2 (uncharacterized)
to candidate WP_012991460.1 THAL_RS02075 homocitrate synthase
Query= curated2:Q8RCF9 (384 letters) >NCBI__GCF_000025605.1:WP_012991460.1 Length = 316 Score = 243 bits (620), Expect = 5e-69 Identities = 131/317 (41%), Positives = 196/317 (61%), Gaps = 4/317 (1%) Query: 9 VYIVDTTLRDGEQTAGVVFANNEKIRIAQMLDEIGIDQLEVGIPTMGGDEKETVAKIAKL 68 VYI DTTLR+G Q+ + + E+ + L + ++EVG+P G +E+E + K+ K Sbjct: 3 VYITDTTLREGIQSPSLELSLEERYALFNHLVSLNFYEIEVGVPAKGEEEREYIRKLTKG 62 Query: 69 GLKASIMAWNRAVVKDVQESLECGVDAVAISISTSDIHIEHKLKKTRQWVLDSMTEAVRF 128 ++ WNRA +KD++ SL C V V ++ SDI IE KL+K+R+++ E V Sbjct: 63 EHADRVIVWNRANIKDIEYSLSCNVKKVEVAFPVSDIMIEKKLRKSREYLKGLAKEIVPC 122 Query: 129 AKKEGVYVSVNAEDASRTDMNFLIEFARCAKQAGADRLRFCDTVGFLDPFKTYEMVKAIK 188 K++G+Y+SV EDASR D NFL+EF K GADR+R DTVG ++P ++VK + Sbjct: 123 CKEKGLYLSVGLEDASRADYNFLLEFVELVKTHGADRVRLSDTVGVMNPLSVAKVVKDLS 182 Query: 189 DAVDIEIEMHTHNDFGMATANALAGVKAGAKFVGVTVNGLGERAGNAALEEVVMALKYVY 248 + D+E+ H HNDFGMATANA+ V +GAKFV ++ GLGER G EEVV+ L+ + Sbjct: 183 NITDVEV--HFHNDFGMATANAVVAVMSGAKFVNSSLLGLGERCGITPTEEVVIYLEVIL 240 Query: 249 KMDLGIDTSR-FREISEYVALASGRPLPPSKAIVGKNVFAHESGIHVDGALKNPYTYEVF 307 ++ GID + + +I E+V + +G + +K I+G N F ++S IH+DG K+ TY F Sbjct: 241 GINTGIDIRKLYEKIREFVNM-TGIKVHDNKPIIGTNAFTNKSRIHIDGLSKSKDTYLPF 299 Query: 308 DPQEVGLERQIVIGKHS 324 DPQ +G +I G +S Sbjct: 300 DPQLIGEMSKICKGYYS 316 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 316 Length adjustment: 29 Effective length of query: 355 Effective length of database: 287 Effective search space: 101885 Effective search space used: 101885 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory