Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate WP_013011633.1 DACET_RS11925 cysteine synthase A
Query= BRENDA::P9WP53 (323 letters) >NCBI__GCF_000025725.1:WP_013011633.1 Length = 315 Score = 166 bits (421), Expect = 5e-46 Identities = 103/312 (33%), Positives = 168/312 (53%), Gaps = 25/312 (8%) Query: 11 LGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEADGLLRP 70 +G TPLV L + ++ + ++AK+E RNP S+K R A +I+Q G L+ Sbjct: 11 IGETPLVRLNSIQGKYKNN-------IFAKVEGRNPAYSVKCRVAAGIIKQGIESGKLKE 63 Query: 71 GATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSAAEGGSN 130 G TI+E TSGNTGI L+ A G+++ +MP+ ++ERR +++ +G ++I + + G Sbjct: 64 GMTIIEATSGNTGIGLSYAGAALGFKVAIIMPDTMTMERRMMMQAFGTELILTDGKLGMK 123 Query: 131 TAVATAKELAATNP-SWVMLYQYGNPANTDSHYCGTGPELLADLP-EITHFVAGLGTTGT 188 AVA A E+ A P + + Q+ NPAN H TGPE+ D ++ FV+G+GT GT Sbjct: 124 GAVALADEMVAKEPEKYFLANQFRNPANPLIHEATTGPEIFRDTDGKVDVFVSGVGTGGT 183 Query: 189 LMGTGRFLR-EHVANVKIVAAEP-------------RYGEGVYALRNMDEGFVPELYDPE 234 + G R+L+ E N+ VAAEP G + ++ + GF+PE D Sbjct: 184 ITGVSRYLKNEKGLNILTVAAEPVKSPVISQFIEKQPLQPGPHTIQGIGAGFIPETLDVS 243 Query: 235 ILTARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALVVA 294 ++ + +A R L EGI +G+S+GA + AA+ G+ +I +++ Sbjct: 244 LIDDVEQIDDENAKEYARRLAREEGIISGVSSGAAVCAAIQAIEKYKLEGK--NIVVILP 301 Query: 295 DAGWKYLSTGAY 306 D+G +YLS+G + Sbjct: 302 DSGERYLSSGLF 313 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 315 Length adjustment: 28 Effective length of query: 295 Effective length of database: 287 Effective search space: 84665 Effective search space used: 84665 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory