Align Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial; Beta-alanine-pyruvate aminotransferase 2; EC 2.6.1.44 (characterized)
to candidate WP_013009663.1 DACET_RS01590 aspartate aminotransferase family protein
Query= SwissProt::Q94AL9 (477 letters) >NCBI__GCF_000025725.1:WP_013009663.1 Length = 389 Score = 204 bits (520), Expect = 3e-57 Identities = 138/400 (34%), Positives = 202/400 (50%), Gaps = 50/400 (12%) Query: 78 RKPLNIVDGKMQYLFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKRLQHPTVLYL 137 R PL+ V G+ L D+ G Y D +GI+VVN GH HP V E + Q L H + LY Sbjct: 10 RYPLSFVKGEGCRLTDDKGEIYFDFGSGISVVNLGHSHPAVTESICTQAGTLIHTSNLYN 69 Query: 138 NHAIADFSEALASKLP-----GDLKVVFFTNSGTEANELALMMAKLYTGCQ------DIV 186 E LA KL GD VFF NSG EANE AL +A++Y ++ Sbjct: 70 ----IPVQERLADKLSRRSFGGD---VFFCNSGMEANEAALKLARIYGNTHFEGKRLRVI 122 Query: 187 AVRNGYHGNAAATMGATGQSMWK--FNVVQNSVHHALNPDPYRGVFGSDGEKYAKDLQDL 244 + N +HG + T+ ATGQ K F V + H A D L Sbjct: 123 TLENSFHGRSYMTLSATGQDKIKKGFEPVADFFTHIP----------------ANDFDAL 166 Query: 245 IQYGTTGHIAGFICEAIQGVGGIVELAPGYLSAAYDTVKKAGGLFIADEVQSGFARTGNF 304 + G +A F+ E IQG GG+ L YL+ D +K G + I DE+Q+GF RTG++ Sbjct: 167 KREVDKGDVAAFMLELIQGEGGLCALNKKYLAQCADFCRKEGVMLILDEIQTGFCRTGSY 226 Query: 305 WGFEAHNVVPDIVTMAKGIGNGFPLGAVVTTPEIAGVLTRRSYFNTFGGNSVSTTAGLAV 364 + +E + PD++T+AKGI NG P+GA++ PE A +T ++ TFGGN ++ A LAV Sbjct: 227 FAYEQFGIEPDVITLAKGIANGVPMGAMIAKPEFAKYMTPGTHGTTFGGNFLACAAALAV 286 Query: 365 LNVIEKEKLQENAAMVGSYLKEKLTQLKEKHEIIGDVRGRGLMLGVELVSDRKLKTPATA 424 +V+ + E G+Y+KE L + E ++ V G G+MLG ++ +K Sbjct: 287 FDVMNADGFLEEVNEKGAYMKEALENIFEGTDV--TVLGMGMMLGAKIPGRQK------- 337 Query: 425 ETLHIMDQMKELGVLIGKGGYFGNVFRITPPLCFTKDDAD 464 +++ E +L+ G+ +V RI PPL +++D D Sbjct: 338 ---EFINKAIENKLLLVPAGH--DVVRIYPPLTISQEDLD 372 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 473 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 389 Length adjustment: 32 Effective length of query: 445 Effective length of database: 357 Effective search space: 158865 Effective search space used: 158865 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory